BLASTX nr result
ID: Rauwolfia21_contig00017673
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00017673 (1155 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004305463.1| PREDICTED: trimethylguanosine synthase-like ... 62 6e-07 gb|EMJ17054.1| hypothetical protein PRUPE_ppa010390mg [Prunus pe... 62 6e-07 >ref|XP_004305463.1| PREDICTED: trimethylguanosine synthase-like [Fragaria vesca subsp. vesca] Length = 249 Score = 61.6 bits (148), Expect = 6e-07 Identities = 24/31 (77%), Positives = 31/31 (100%) Frame = +1 Query: 1063 GDVVFLSPPWGGPSYKRMKKFSLELLKPKEG 1155 GD+VFLSPPWGGPSY+R+KKF+L+LL+PK+G Sbjct: 152 GDIVFLSPPWGGPSYRRVKKFTLDLLEPKDG 182 >gb|EMJ17054.1| hypothetical protein PRUPE_ppa010390mg [Prunus persica] Length = 251 Score = 61.6 bits (148), Expect = 6e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 1063 GDVVFLSPPWGGPSYKRMKKFSLELLKPKEG 1155 GDVVFLSPPWGGPSYK +KKF+L+LLKPK+G Sbjct: 151 GDVVFLSPPWGGPSYKWVKKFTLDLLKPKDG 181