BLASTX nr result
ID: Rauwolfia21_contig00017623
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00017623 (752 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004291327.1| PREDICTED: uncharacterized protein LOC101297... 59 2e-06 gb|EMJ25741.1| hypothetical protein PRUPE_ppa024578mg [Prunus pe... 59 2e-06 gb|ABK93183.1| unknown [Populus trichocarpa] 59 2e-06 gb|EOY15136.1| LYR family of Fe/S cluster biogenesis protein [Th... 58 4e-06 gb|EXB81504.1| hypothetical protein L484_014312 [Morus notabilis] 57 5e-06 emb|CBI18916.3| unnamed protein product [Vitis vinifera] 57 9e-06 >ref|XP_004291327.1| PREDICTED: uncharacterized protein LOC101297027 [Fragaria vesca subsp. vesca] Length = 83 Score = 58.9 bits (141), Expect = 2e-06 Identities = 31/41 (75%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = -2 Query: 502 MVFFLDLQDFLLRARVLKLYRQALRTTRRAPAQARGS-RTT 383 M DLQDFL+RARVLKLYRQALR TRRAP ARG RTT Sbjct: 1 MALAFDLQDFLIRARVLKLYRQALRVTRRAPVDARGELRTT 41 >gb|EMJ25741.1| hypothetical protein PRUPE_ppa024578mg [Prunus persica] Length = 83 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -2 Query: 502 MVFFLDLQDFLLRARVLKLYRQALRTTRRAPAQARG 395 M LDLQDFLLRARVLKLYRQALR TRR+P ARG Sbjct: 1 MALALDLQDFLLRARVLKLYRQALRITRRSPVDARG 36 >gb|ABK93183.1| unknown [Populus trichocarpa] Length = 41 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -2 Query: 502 MVFFLDLQDFLLRARVLKLYRQALRTTRRAPAQARG 395 MV LQDF+LRARVLKLYRQALRTTRRAP ARG Sbjct: 1 MVLSFGLQDFILRARVLKLYRQALRTTRRAPGDARG 36 >gb|EOY15136.1| LYR family of Fe/S cluster biogenesis protein [Theobroma cacao] Length = 82 Score = 57.8 bits (138), Expect = 4e-06 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -2 Query: 502 MVFFLDLQDFLLRARVLKLYRQALRTTRRAPAQAR 398 MV LDLQDFLLRARVLKLYRQALRT RRAP +R Sbjct: 1 MVLSLDLQDFLLRARVLKLYRQALRTARRAPEHSR 35 >gb|EXB81504.1| hypothetical protein L484_014312 [Morus notabilis] Length = 82 Score = 57.4 bits (137), Expect = 5e-06 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -2 Query: 502 MVFFLDLQDFLLRARVLKLYRQALRTTRRAPAQAR 398 M DLQDF+LRARVLKLYRQALRTTRRAP AR Sbjct: 1 MALSFDLQDFILRARVLKLYRQALRTTRRAPVHAR 35 >emb|CBI18916.3| unnamed protein product [Vitis vinifera] Length = 140 Score = 56.6 bits (135), Expect = 9e-06 Identities = 29/36 (80%), Positives = 29/36 (80%) Frame = -2 Query: 505 VMVFFLDLQDFLLRARVLKLYRQALRTTRRAPAQAR 398 VMV LDLQDFLLRARVLKLYRQALR RAP AR Sbjct: 59 VMVLLLDLQDFLLRARVLKLYRQALRVAGRAPEHAR 94