BLASTX nr result
ID: Rauwolfia21_contig00017189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00017189 (800 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520529.1| pentatricopeptide repeat-containing protein,... 83 1e-13 ref|XP_004240613.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-12 gb|EMJ09415.1| hypothetical protein PRUPE_ppa018916mg, partial [... 77 7e-12 ref|XP_003632146.1| PREDICTED: pentatricopeptide repeat-containi... 77 9e-12 emb|CBI16090.3| unnamed protein product [Vitis vinifera] 77 9e-12 ref|XP_004289402.1| PREDICTED: pentatricopeptide repeat-containi... 75 3e-11 ref|XP_002314162.2| hypothetical protein POPTR_0009s04000g, part... 74 6e-11 gb|EOY33964.1| Pentatricopeptide repeat superfamily protein [The... 71 4e-10 gb|EPS72239.1| hypothetical protein M569_02517, partial [Genlise... 69 1e-09 gb|EOX91779.1| Pentatricopeptide repeat (PPR) superfamily protei... 69 1e-09 ref|XP_004160205.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 68 3e-09 ref|XP_004143208.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_002302000.2| pentatricopeptide repeat-containing family p... 67 6e-09 ref|XP_002280360.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_006342194.1| PREDICTED: pentatricopeptide repeat-containi... 67 9e-09 ref|XP_004238467.1| PREDICTED: pentatricopeptide repeat-containi... 67 9e-09 gb|ABK26521.1| unknown [Picea sitchensis] 67 9e-09 gb|EMJ17597.1| hypothetical protein PRUPE_ppa022530mg [Prunus pe... 66 1e-08 gb|EOY05619.1| Pentatricopeptide repeat (PPR) superfamily protei... 66 2e-08 gb|EMJ17324.1| hypothetical protein PRUPE_ppa018932mg [Prunus pe... 65 4e-08 >ref|XP_002520529.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540371|gb|EEF41942.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 606 Score = 83.2 bits (204), Expect = 1e-13 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = +3 Query: 3 AIRLVELCPSDPVTYIVLANVLATEGNWNDAAGVRKLMCDRGVRKKPGSSWI 158 A +L+EL P DP TYI+L+N+LATEG W+DAA VRKLMCDRGVRK PG SWI Sbjct: 555 ARKLLELWPDDPATYILLSNMLATEGYWDDAADVRKLMCDRGVRKNPGYSWI 606 >ref|XP_004240613.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Solanum lycopersicum] Length = 536 Score = 79.0 bits (193), Expect = 2e-12 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = +3 Query: 3 AIRLVELCPSDPVTYIVLANVLATEGNWNDAAGVRKLMCDRGVRKKPGSSWI 158 A +LVEL P+DP TY++LANVLA EGNW DA G RKLM DRG+ KKPG SW+ Sbjct: 485 AKKLVELRPNDPATYVLLANVLALEGNWKDAEGQRKLMLDRGLSKKPGYSWL 536 >gb|EMJ09415.1| hypothetical protein PRUPE_ppa018916mg, partial [Prunus persica] Length = 562 Score = 77.0 bits (188), Expect = 7e-12 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = +3 Query: 3 AIRLVELCPSDPVTYIVLANVLATEGNWNDAAGVRKLMCDRGVRKKPGSSWI 158 A +L EL P+DP TYI+L+NVL T G W+DAAGVRKLM DRG+RK PG SWI Sbjct: 511 AKKLQELWPNDPATYILLSNVLVTGGCWDDAAGVRKLMYDRGIRKTPGHSWI 562 >ref|XP_003632146.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Vitis vinifera] Length = 628 Score = 76.6 bits (187), Expect = 9e-12 Identities = 31/52 (59%), Positives = 44/52 (84%) Frame = +3 Query: 3 AIRLVELCPSDPVTYIVLANVLATEGNWNDAAGVRKLMCDRGVRKKPGSSWI 158 A +L+++CP+DPV Y++L+NV AT G W++ A +RK+MCDRGVRK+PG SWI Sbjct: 577 AKKLLQMCPNDPVIYVLLSNVQATVGYWDNVASIRKVMCDRGVRKEPGYSWI 628 >emb|CBI16090.3| unnamed protein product [Vitis vinifera] Length = 458 Score = 76.6 bits (187), Expect = 9e-12 Identities = 31/52 (59%), Positives = 44/52 (84%) Frame = +3 Query: 3 AIRLVELCPSDPVTYIVLANVLATEGNWNDAAGVRKLMCDRGVRKKPGSSWI 158 A +L+++CP+DPV Y++L+NV AT G W++ A +RK+MCDRGVRK+PG SWI Sbjct: 407 AKKLLQMCPNDPVIYVLLSNVQATVGYWDNVASIRKVMCDRGVRKEPGYSWI 458 >ref|XP_004289402.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Fragaria vesca subsp. vesca] Length = 558 Score = 75.1 bits (183), Expect = 3e-11 Identities = 34/52 (65%), Positives = 41/52 (78%) Frame = +3 Query: 3 AIRLVELCPSDPVTYIVLANVLATEGNWNDAAGVRKLMCDRGVRKKPGSSWI 158 A L +LCP+D TYI+L+NVL T G+W+DAAGVRK M DRG+RK PG SWI Sbjct: 507 ATTLQQLCPNDHGTYILLSNVLLTRGSWDDAAGVRKFMYDRGIRKTPGYSWI 558 >ref|XP_002314162.2| hypothetical protein POPTR_0009s04000g, partial [Populus trichocarpa] gi|550330984|gb|EEE88117.2| hypothetical protein POPTR_0009s04000g, partial [Populus trichocarpa] Length = 606 Score = 73.9 bits (180), Expect = 6e-11 Identities = 31/48 (64%), Positives = 42/48 (87%) Frame = +3 Query: 3 AIRLVELCPSDPVTYIVLANVLATEGNWNDAAGVRKLMCDRGVRKKPG 146 A +L+EL P+DP TY++L++VL +GNW+DAA +RKLMCDRG+RKKPG Sbjct: 551 AKKLLELWPNDPATYVLLSSVLTVDGNWDDAADLRKLMCDRGLRKKPG 598 >gb|EOY33964.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 623 Score = 71.2 bits (173), Expect = 4e-10 Identities = 33/52 (63%), Positives = 40/52 (76%) Frame = +3 Query: 3 AIRLVELCPSDPVTYIVLANVLATEGNWNDAAGVRKLMCDRGVRKKPGSSWI 158 A RL+EL P+DP TY++L+ VL +W+DAAGV KLM DRGVRK PG SWI Sbjct: 572 ANRLLELWPNDPATYVLLSKVLKMGNDWDDAAGVCKLMSDRGVRKNPGCSWI 623 >gb|EPS72239.1| hypothetical protein M569_02517, partial [Genlisea aurea] Length = 786 Score = 69.3 bits (168), Expect = 1e-09 Identities = 33/56 (58%), Positives = 40/56 (71%) Frame = +3 Query: 3 AIRLVELCPSDPVTYIVLANVLATEGNWNDAAGVRKLMCDRGVRKKPGSSWI*FEN 170 A RL EL P + TYI+LAN+ AT G W+ A VRKLM DRGV+K+PG SW+ EN Sbjct: 606 AERLFELIPENDGTYILLANMFATSGRWDQVAAVRKLMRDRGVKKEPGCSWLEVEN 661 >gb|EOX91779.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 718 Score = 69.3 bits (168), Expect = 1e-09 Identities = 33/52 (63%), Positives = 41/52 (78%) Frame = +3 Query: 3 AIRLVELCPSDPVTYIVLANVLATEGNWNDAAGVRKLMCDRGVRKKPGSSWI 158 A +L+EL PS+ V Y++LAN+ A+ G W +AA VRKLM DRGVRKKPG SWI Sbjct: 535 ANQLLELEPSNAVPYVMLANMYASSGKWEEAATVRKLMRDRGVRKKPGCSWI 586 >ref|XP_004160205.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g11290-like [Cucumis sativus] Length = 616 Score = 68.2 bits (165), Expect = 3e-09 Identities = 29/52 (55%), Positives = 41/52 (78%) Frame = +3 Query: 3 AIRLVELCPSDPVTYIVLANVLATEGNWNDAAGVRKLMCDRGVRKKPGSSWI 158 A +L+EL P DP TYI+L+N L +G W+DAA +R+LM +RGV+K+PG SW+ Sbjct: 565 AKKLLELYPYDPATYIMLSNALGRDGYWDDAASIRRLMSNRGVKKEPGFSWM 616 >ref|XP_004143208.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Cucumis sativus] Length = 616 Score = 68.2 bits (165), Expect = 3e-09 Identities = 29/52 (55%), Positives = 41/52 (78%) Frame = +3 Query: 3 AIRLVELCPSDPVTYIVLANVLATEGNWNDAAGVRKLMCDRGVRKKPGSSWI 158 A +L+EL P DP TYI+L+N L +G W+DAA +R+LM +RGV+K+PG SW+ Sbjct: 565 AKKLLELYPYDPATYIMLSNALGRDGYWDDAASIRRLMSNRGVKKEPGFSWM 616 >ref|XP_002302000.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550344162|gb|EEE81273.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 797 Score = 67.4 bits (163), Expect = 6e-09 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = +3 Query: 3 AIRLVELCPSDPVTYIVLANVLATEGNWNDAAGVRKLMCDRGVRKKPGSSWI*FEN 170 A RL EL P TY++L+N+ A G WND A VRKLM DRGV+K+PG SWI EN Sbjct: 617 AERLFELKPQHDGTYVLLSNMYAVAGQWNDMAKVRKLMRDRGVKKEPGCSWIEVEN 672 >ref|XP_002280360.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Vitis vinifera] Length = 799 Score = 67.0 bits (162), Expect = 7e-09 Identities = 32/56 (57%), Positives = 40/56 (71%) Frame = +3 Query: 3 AIRLVELCPSDPVTYIVLANVLATEGNWNDAAGVRKLMCDRGVRKKPGSSWI*FEN 170 A RL EL P TY++L+N+ AT G W+D A VRKLM D+GV+K+PG SWI EN Sbjct: 619 AERLFELMPQHDGTYVLLSNMYATVGRWDDVAKVRKLMRDKGVKKEPGCSWIEVEN 674 >ref|XP_006342194.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Solanum tuberosum] Length = 804 Score = 66.6 bits (161), Expect = 9e-09 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = +3 Query: 3 AIRLVELCPSDPVTYIVLANVLATEGNWNDAAGVRKLMCDRGVRKKPGSSWI*FEN 170 A +L EL P TYI+LAN A G W+DAA VRKLM D+GV+K+PG SWI EN Sbjct: 624 AEQLFELTPQHDGTYILLANTFAAAGRWDDAAKVRKLMRDQGVKKEPGCSWIKVEN 679 >ref|XP_004238467.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Solanum lycopersicum] Length = 804 Score = 66.6 bits (161), Expect = 9e-09 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = +3 Query: 3 AIRLVELCPSDPVTYIVLANVLATEGNWNDAAGVRKLMCDRGVRKKPGSSWI*FEN 170 A +L EL P TYI+LAN A G W+DAA VRKLM D+GV+K+PG SWI EN Sbjct: 624 AEQLFELTPQHDGTYILLANTFAAAGRWDDAAKVRKLMRDQGVKKEPGCSWIKVEN 679 >gb|ABK26521.1| unknown [Picea sitchensis] Length = 370 Score = 66.6 bits (161), Expect = 9e-09 Identities = 28/54 (51%), Positives = 40/54 (74%) Frame = +3 Query: 9 RLVELCPSDPVTYIVLANVLATEGNWNDAAGVRKLMCDRGVRKKPGSSWI*FEN 170 +L+EL P +P TY++L+N+ A G W+DA VRK+M DR V+K+PG SWI +N Sbjct: 192 QLIELTPENPGTYVLLSNIYAAAGRWDDAGKVRKMMKDRSVKKEPGCSWIEVQN 245 >gb|EMJ17597.1| hypothetical protein PRUPE_ppa022530mg [Prunus persica] Length = 689 Score = 66.2 bits (160), Expect = 1e-08 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = +3 Query: 3 AIRLVELCPSDPVTYIVLANVLATEGNWNDAAGVRKLMCDRGVRKKPGSSWI*FEN 170 A RL EL P TYI+L+N+ A G W+D A VRKLM DRGV+K+PG SWI EN Sbjct: 509 AERLFELVPQHDGTYILLSNLYAAIGRWDDVAKVRKLMRDRGVKKEPGCSWIDVEN 564 >gb|EOY05619.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 788 Score = 65.9 bits (159), Expect = 2e-08 Identities = 30/56 (53%), Positives = 39/56 (69%) Frame = +3 Query: 3 AIRLVELCPSDPVTYIVLANVLATEGNWNDAAGVRKLMCDRGVRKKPGSSWI*FEN 170 A RL+EL P +Y++L+N+ AT G W+D A RKLM DRGV K+PG SW+ EN Sbjct: 608 AERLIELMPQHDGSYVLLSNMYATAGRWDDVAKTRKLMRDRGVHKEPGCSWVEVEN 663 >gb|EMJ17324.1| hypothetical protein PRUPE_ppa018932mg [Prunus persica] Length = 689 Score = 64.7 bits (156), Expect = 4e-08 Identities = 32/56 (57%), Positives = 39/56 (69%) Frame = +3 Query: 3 AIRLVELCPSDPVTYIVLANVLATEGNWNDAAGVRKLMCDRGVRKKPGSSWI*FEN 170 A RL EL P TYI+L+N+ A G W+D A VR+LM DRGV+K+PG SWI EN Sbjct: 509 AERLFELVPQHDGTYILLSNLYAAIGRWDDVAKVRQLMRDRGVKKEPGCSWIDVEN 564