BLASTX nr result
ID: Rauwolfia21_contig00017077
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00017077 (265 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003592425.1| Annotation was added to scaffolds in Novembe... 55 7e-06 ref|XP_003592424.1| Annotation was added to scaffolds in Novembe... 55 7e-06 ref|XP_003592423.1| Annotation was added to scaffolds in Novembe... 55 7e-06 >ref|XP_003592425.1| Annotation was added to scaffolds in November 2011~Long chain fatty acid-CoA ligase [Medicago truncatula] gi|355481473|gb|AES62676.1| Annotation was added to scaffolds in November 2011~Long chain fatty acid-CoA ligase [Medicago truncatula] Length = 630 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 91 LVYEDLAQLCNDPRAKAAVLAEMDAVGSEA 2 +VY DL QLCNDPRAKAAVLAEMDAVG EA Sbjct: 540 IVYNDLTQLCNDPRAKAAVLAEMDAVGREA 569 >ref|XP_003592424.1| Annotation was added to scaffolds in November 2011~Long chain fatty acid-CoA ligase [Medicago truncatula] gi|355481472|gb|AES62675.1| Annotation was added to scaffolds in November 2011~Long chain fatty acid-CoA ligase [Medicago truncatula] Length = 697 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 91 LVYEDLAQLCNDPRAKAAVLAEMDAVGSEA 2 +VY DL QLCNDPRAKAAVLAEMDAVG EA Sbjct: 607 IVYNDLTQLCNDPRAKAAVLAEMDAVGREA 636 >ref|XP_003592423.1| Annotation was added to scaffolds in November 2011~Long chain fatty acid-CoA ligase [Medicago truncatula] gi|355481471|gb|AES62674.1| Annotation was added to scaffolds in November 2011~Long chain fatty acid-CoA ligase [Medicago truncatula] Length = 713 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 91 LVYEDLAQLCNDPRAKAAVLAEMDAVGSEA 2 +VY DL QLCNDPRAKAAVLAEMDAVG EA Sbjct: 623 IVYNDLTQLCNDPRAKAAVLAEMDAVGREA 652