BLASTX nr result
ID: Rauwolfia21_contig00014802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00014802 (484 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004297205.1| PREDICTED: uncharacterized protein LOC101300... 78 1e-12 gb|EMJ23184.1| hypothetical protein PRUPE_ppa002846mg [Prunus pe... 77 2e-12 ref|XP_004239023.1| PREDICTED: uncharacterized protein LOC101260... 76 4e-12 gb|EXB44890.1| hypothetical protein L484_026472 [Morus notabilis] 75 7e-12 ref|XP_002512034.1| conserved hypothetical protein [Ricinus comm... 75 7e-12 ref|XP_002312345.2| hypothetical protein POPTR_0008s10850g [Popu... 74 2e-11 ref|XP_006348651.1| PREDICTED: stress response protein NST1-like... 73 3e-11 ref|XP_002314922.2| hypothetical protein POPTR_0010s14890g [Popu... 73 3e-11 ref|XP_006484248.1| PREDICTED: uncharacterized protein LOC102622... 73 4e-11 ref|XP_006437863.1| hypothetical protein CICLE_v10030834mg [Citr... 73 4e-11 gb|ESW25468.1| hypothetical protein PHAVU_003G038600g [Phaseolus... 72 8e-11 ref|XP_002514618.1| hypothetical protein RCOM_1467930 [Ricinus c... 72 8e-11 gb|EOY01601.1| Chaperone DnaJ-domain superfamily protein, putati... 71 1e-10 emb|CBI27324.3| unnamed protein product [Vitis vinifera] 71 2e-10 ref|XP_006391060.1| hypothetical protein EUTSA_v10018302mg [Eutr... 70 2e-10 ref|XP_004239456.1| PREDICTED: uncharacterized protein LOC101261... 69 5e-10 ref|XP_003520133.2| PREDICTED: lisH domain-containing protein C1... 69 6e-10 ref|XP_006301158.1| hypothetical protein CARUB_v10021556mg [Caps... 69 6e-10 ref|XP_002887221.1| heat shock protein binding protein [Arabidop... 69 6e-10 ref|XP_006573168.1| PREDICTED: dentin sialophosphoprotein-like i... 68 1e-09 >ref|XP_004297205.1| PREDICTED: uncharacterized protein LOC101300999 [Fragaria vesca subsp. vesca] Length = 659 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -2 Query: 483 VRAAYKRALLTFHPDRASRSDIRQLVEAEEKFKLISRMKEKLL 355 V AAYKRALL FHPDRASR+DIRQ+VEAEEKFKLISRMKEKL+ Sbjct: 612 VHAAYKRALLKFHPDRASRTDIRQMVEAEEKFKLISRMKEKLI 654 >gb|EMJ23184.1| hypothetical protein PRUPE_ppa002846mg [Prunus persica] Length = 628 Score = 77.0 bits (188), Expect = 2e-12 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -2 Query: 483 VRAAYKRALLTFHPDRASRSDIRQLVEAEEKFKLISRMKEKLLPVS 346 V AAYKRALL FHPDRASR+D+RQ VEAEEKFKLISRMKEKLL S Sbjct: 581 VHAAYKRALLKFHPDRASRTDVRQQVEAEEKFKLISRMKEKLLLTS 626 >ref|XP_004239023.1| PREDICTED: uncharacterized protein LOC101260227 [Solanum lycopersicum] Length = 545 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -2 Query: 483 VRAAYKRALLTFHPDRASRSDIRQLVEAEEKFKLISRMKEKLLP 352 VRAAYK+ALL FHPDRASRSD++Q VEAEEKFKLISRMK+K LP Sbjct: 500 VRAAYKKALLKFHPDRASRSDLQQQVEAEEKFKLISRMKDKYLP 543 >gb|EXB44890.1| hypothetical protein L484_026472 [Morus notabilis] Length = 691 Score = 75.5 bits (184), Expect = 7e-12 Identities = 38/46 (82%), Positives = 40/46 (86%) Frame = -2 Query: 483 VRAAYKRALLTFHPDRASRSDIRQLVEAEEKFKLISRMKEKLLPVS 346 V AAYKRALL FHPDRAS++DIRQ VEAEEKFKLISRMKEK L S Sbjct: 644 VHAAYKRALLKFHPDRASKTDIRQQVEAEEKFKLISRMKEKFLSTS 689 >ref|XP_002512034.1| conserved hypothetical protein [Ricinus communis] gi|223549214|gb|EEF50703.1| conserved hypothetical protein [Ricinus communis] Length = 632 Score = 75.5 bits (184), Expect = 7e-12 Identities = 38/46 (82%), Positives = 40/46 (86%) Frame = -2 Query: 483 VRAAYKRALLTFHPDRASRSDIRQLVEAEEKFKLISRMKEKLLPVS 346 V AAYKRALL FHPDRASR+DIRQ VEAEEKFKLISRMK+K L S Sbjct: 585 VHAAYKRALLKFHPDRASRTDIRQQVEAEEKFKLISRMKQKFLSTS 630 >ref|XP_002312345.2| hypothetical protein POPTR_0008s10850g [Populus trichocarpa] gi|566183350|ref|XP_006379715.1| hypothetical protein POPTR_0008s10850g [Populus trichocarpa] gi|550332810|gb|EEE89712.2| hypothetical protein POPTR_0008s10850g [Populus trichocarpa] gi|550332811|gb|ERP57512.1| hypothetical protein POPTR_0008s10850g [Populus trichocarpa] Length = 695 Score = 73.9 bits (180), Expect = 2e-11 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = -2 Query: 483 VRAAYKRALLTFHPDRASRSDIRQLVEAEEKFKLISRMKEKLLPVS 346 V AAYKRALL FHPDRAS++DIR+ VEAEEKFKLISRMKEK L S Sbjct: 648 VHAAYKRALLKFHPDRASKTDIRRQVEAEEKFKLISRMKEKFLSTS 693 >ref|XP_006348651.1| PREDICTED: stress response protein NST1-like [Solanum tuberosum] Length = 544 Score = 73.2 bits (178), Expect = 3e-11 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -2 Query: 483 VRAAYKRALLTFHPDRASRSDIRQLVEAEEKFKLISRMKEKLLP 352 VR AYK+ALL FHPDRAS+SD++Q VEAEEKFKLISRMK+K LP Sbjct: 499 VRVAYKKALLKFHPDRASQSDLQQQVEAEEKFKLISRMKDKYLP 542 >ref|XP_002314922.2| hypothetical protein POPTR_0010s14890g [Populus trichocarpa] gi|550329836|gb|EEF01093.2| hypothetical protein POPTR_0010s14890g [Populus trichocarpa] Length = 724 Score = 73.2 bits (178), Expect = 3e-11 Identities = 37/46 (80%), Positives = 39/46 (84%) Frame = -2 Query: 483 VRAAYKRALLTFHPDRASRSDIRQLVEAEEKFKLISRMKEKLLPVS 346 V AAYKRALL HPDRAS++DIRQ VEAEEKFKLISRMKEK L S Sbjct: 677 VHAAYKRALLKLHPDRASKTDIRQQVEAEEKFKLISRMKEKFLSTS 722 >ref|XP_006484248.1| PREDICTED: uncharacterized protein LOC102622387 isoform X1 [Citrus sinensis] gi|568861520|ref|XP_006484249.1| PREDICTED: uncharacterized protein LOC102622387 isoform X2 [Citrus sinensis] Length = 715 Score = 72.8 bits (177), Expect = 4e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -2 Query: 483 VRAAYKRALLTFHPDRASRSDIRQLVEAEEKFKLISRMKEKLL 355 V AAYKRALL FHPDRAS++D+RQ VEAEEKFKLISRM+EK L Sbjct: 668 VHAAYKRALLRFHPDRASKTDVRQQVEAEEKFKLISRMREKFL 710 >ref|XP_006437863.1| hypothetical protein CICLE_v10030834mg [Citrus clementina] gi|567890687|ref|XP_006437864.1| hypothetical protein CICLE_v10030834mg [Citrus clementina] gi|557540059|gb|ESR51103.1| hypothetical protein CICLE_v10030834mg [Citrus clementina] gi|557540060|gb|ESR51104.1| hypothetical protein CICLE_v10030834mg [Citrus clementina] Length = 715 Score = 72.8 bits (177), Expect = 4e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -2 Query: 483 VRAAYKRALLTFHPDRASRSDIRQLVEAEEKFKLISRMKEKLL 355 V AAYKRALL FHPDRAS++D+RQ VEAEEKFKLISRM+EK L Sbjct: 668 VHAAYKRALLRFHPDRASKTDVRQQVEAEEKFKLISRMREKFL 710 >gb|ESW25468.1| hypothetical protein PHAVU_003G038600g [Phaseolus vulgaris] Length = 572 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 483 VRAAYKRALLTFHPDRASRSDIRQLVEAEEKFKLISRMKEKLLPVS 346 V+AAYKRAL TFHPDRAS+SD+R VEAEEKFKLISR+K+K L S Sbjct: 525 VQAAYKRALFTFHPDRASKSDVRAQVEAEEKFKLISRLKDKFLLTS 570 >ref|XP_002514618.1| hypothetical protein RCOM_1467930 [Ricinus communis] gi|223546222|gb|EEF47724.1| hypothetical protein RCOM_1467930 [Ricinus communis] Length = 451 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -2 Query: 483 VRAAYKRALLTFHPDRASRSDIRQLVEAEEKFKLISRMKEKLL 355 VR AYK+ALL FHPDRASRSDIRQ +EAEEKFKLISR KEK + Sbjct: 408 VRTAYKQALLRFHPDRASRSDIRQQIEAEEKFKLISRAKEKFM 450 >gb|EOY01601.1| Chaperone DnaJ-domain superfamily protein, putative isoform 1 [Theobroma cacao] gi|508709705|gb|EOY01602.1| Chaperone DnaJ-domain superfamily protein, putative isoform 1 [Theobroma cacao] Length = 634 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 483 VRAAYKRALLTFHPDRASRSDIRQLVEAEEKFKLISRMKEKLLPVS 346 V AAYKRA+L FHPDRAS+++IR+ VEAEEKFKLISRMKEK L S Sbjct: 587 VHAAYKRAVLRFHPDRASKTNIREQVEAEEKFKLISRMKEKFLATS 632 >emb|CBI27324.3| unnamed protein product [Vitis vinifera] Length = 620 Score = 70.9 bits (172), Expect = 2e-10 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -2 Query: 483 VRAAYKRALLTFHPDRASRSDIRQLVEAEEKFKLISRMKEKLL 355 V AAYKRALL FHPDRASR+DI VEAEEKFKLISRMKEK L Sbjct: 575 VHAAYKRALLKFHPDRASRTDIYHQVEAEEKFKLISRMKEKFL 617 >ref|XP_006391060.1| hypothetical protein EUTSA_v10018302mg [Eutrema salsugineum] gi|557087494|gb|ESQ28346.1| hypothetical protein EUTSA_v10018302mg [Eutrema salsugineum] Length = 609 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -2 Query: 483 VRAAYKRALLTFHPDRASRSDIRQLVEAEEKFKLISRMKEKLL 355 V AAYKRA+L FHPDRASR DI+Q VEAEEKFKLI+RMK+K L Sbjct: 566 VHAAYKRAVLKFHPDRASRGDIKQQVEAEEKFKLIARMKDKFL 608 >ref|XP_004239456.1| PREDICTED: uncharacterized protein LOC101261118 [Solanum lycopersicum] Length = 780 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = -2 Query: 483 VRAAYKRALLTFHPDRASRSDIRQLVEAEEKFKLISRMKEKLLP 352 VR AYK+AL+ FHPD++S DIRQ VEAEEKFKLISRMK+K LP Sbjct: 735 VRVAYKKALMKFHPDKSSGCDIRQQVEAEEKFKLISRMKDKYLP 778 >ref|XP_003520133.2| PREDICTED: lisH domain-containing protein C1711.05-like [Glycine max] Length = 556 Score = 68.9 bits (167), Expect = 6e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 483 VRAAYKRALLTFHPDRASRSDIRQLVEAEEKFKLISRMKEK 361 V AAYKRALL FHPDRAS++D+R VEAEEKFKLISR+KEK Sbjct: 509 VHAAYKRALLKFHPDRASKTDVRAQVEAEEKFKLISRLKEK 549 >ref|XP_006301158.1| hypothetical protein CARUB_v10021556mg [Capsella rubella] gi|482569868|gb|EOA34056.1| hypothetical protein CARUB_v10021556mg [Capsella rubella] Length = 496 Score = 68.9 bits (167), Expect = 6e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 483 VRAAYKRALLTFHPDRASRSDIRQLVEAEEKFKLISRMKEK 361 V AAYKRA+L FHPDRASR DI+Q VEAEEKFKLI+RMK+K Sbjct: 453 VHAAYKRAVLKFHPDRASRGDIKQQVEAEEKFKLIARMKDK 493 >ref|XP_002887221.1| heat shock protein binding protein [Arabidopsis lyrata subsp. lyrata] gi|297333062|gb|EFH63480.1| heat shock protein binding protein [Arabidopsis lyrata subsp. lyrata] Length = 593 Score = 68.9 bits (167), Expect = 6e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 483 VRAAYKRALLTFHPDRASRSDIRQLVEAEEKFKLISRMKEK 361 V AAYKRA+L FHPDRASR DI+Q VEAEEKFKLI+RMK+K Sbjct: 547 VHAAYKRAVLKFHPDRASRGDIKQQVEAEEKFKLIARMKDK 587 >ref|XP_006573168.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Glycine max] Length = 562 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = -2 Query: 483 VRAAYKRALLTFHPDRASRSDIRQLVEAEEKFKLISRMKEKLLPVS 346 V AAYKRALL FHPDRAS++D+R VEAEEKFKLISR KEK S Sbjct: 515 VHAAYKRALLKFHPDRASKTDVRAQVEAEEKFKLISRWKEKFAMTS 560