BLASTX nr result
ID: Rauwolfia21_contig00014795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00014795 (251 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY10563.1| Uncharacterized protein isoform 2 [Theobroma cacao] 59 7e-07 gb|EOY10562.1| Uncharacterized protein isoform 1 [Theobroma cacao] 59 7e-07 ref|XP_002525725.1| ATECP63, putative [Ricinus communis] gi|2235... 57 3e-06 ref|NP_001149410.1| cylicin-1 [Zea mays] gi|195627050|gb|ACG3535... 55 7e-06 ref|XP_002266362.1| PREDICTED: uncharacterized protein LOC100259... 55 1e-05 >gb|EOY10563.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 555 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/57 (54%), Positives = 44/57 (77%), Gaps = 2/57 (3%) Frame = -1 Query: 167 MEDKS-SVMLKEEKVDKEEILLKAESKTKKPDGEEGKK-EIEVELKTKSVEKENSKH 3 M+DKS S+++ EEKV KEE+ K ++K +P+ E+G+K E+E+ELKTKSVEKE H Sbjct: 1 MQDKSESIVIGEEKVKKEELHFKVKTKDMEPNHEKGEKVEVELELKTKSVEKEKPNH 57 >gb|EOY10562.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 560 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/57 (54%), Positives = 44/57 (77%), Gaps = 2/57 (3%) Frame = -1 Query: 167 MEDKS-SVMLKEEKVDKEEILLKAESKTKKPDGEEGKK-EIEVELKTKSVEKENSKH 3 M+DKS S+++ EEKV KEE+ K ++K +P+ E+G+K E+E+ELKTKSVEKE H Sbjct: 1 MQDKSESIVIGEEKVKKEELHFKVKTKDMEPNHEKGEKVEVELELKTKSVEKEKPNH 57 >ref|XP_002525725.1| ATECP63, putative [Ricinus communis] gi|223535025|gb|EEF36708.1| ATECP63, putative [Ricinus communis] Length = 430 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/56 (57%), Positives = 41/56 (73%), Gaps = 5/56 (8%) Frame = -1 Query: 167 MEDKSSVMLK----EEKVDKEEILLKAESKTKKPDGEEGKK-EIEVELKTKSVEKE 15 MEDKS + + EEKV KEE+ LK +SK +P E+G+K E+E+ELKTKSVEKE Sbjct: 1 MEDKSEIAVSGVKIEEKVKKEELHLKVKSKDIEPSDEKGEKSEVEIELKTKSVEKE 56 >ref|NP_001149410.1| cylicin-1 [Zea mays] gi|195627050|gb|ACG35355.1| cylicin-1 [Zea mays] Length = 232 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/53 (52%), Positives = 37/53 (69%) Frame = -1 Query: 164 EDKSSVMLKEEKVDKEEILLKAESKTKKPDGEEGKKEIEVELKTKSVEKENSK 6 +D S LKEEK KEEI LK +SK ++ E+GK+E+EVE++ K VEKE K Sbjct: 3 KDGESAKLKEEKKSKEEIHLKVKSKDERSGEEDGKEEVEVEIEAKFVEKEEVK 55 >ref|XP_002266362.1| PREDICTED: uncharacterized protein LOC100259905 [Vitis vinifera] Length = 382 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/57 (52%), Positives = 43/57 (75%), Gaps = 2/57 (3%) Frame = -1 Query: 167 MEDKSSVMLKE-EKVDKEEILLKAESKTKKPDGE-EGKKEIEVELKTKSVEKENSKH 3 MED S + KE E+V+KEE+ ++ ++K K+P+ E E K+E+E+ELK KSV KEN KH Sbjct: 1 MEDNSESIAKEQERVEKEEVHVQVKNKVKEPNKEKEEKEEMELELKKKSVVKENPKH 57