BLASTX nr result
ID: Rauwolfia21_contig00013734
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00013734 (521 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531340.1| Frataxin, mitochondrial precursor, putative ... 79 5e-13 gb|EOX99241.1| Frataxin [Theobroma cacao] 79 6e-13 ref|XP_006447426.1| hypothetical protein CICLE_v10016814mg [Citr... 79 8e-13 ref|XP_003554058.1| PREDICTED: frataxin, mitochondrial-like [Gly... 77 2e-12 ref|XP_003520940.1| PREDICTED: frataxin, mitochondrial-like [Gly... 77 2e-12 ref|XP_003619899.1| Frataxin-like protein [Medicago truncatula] ... 77 2e-12 ref|XP_002277091.1| PREDICTED: frataxin, mitochondrial isoform 1... 76 4e-12 emb|CAN67530.1| hypothetical protein VITISV_004311 [Vitis vinifera] 76 4e-12 ref|XP_004493241.1| PREDICTED: frataxin, mitochondrial-like [Cic... 76 5e-12 ref|XP_003619909.1| Frataxin-like protein [Medicago truncatula] ... 76 5e-12 gb|EMJ18471.1| hypothetical protein PRUPE_ppa011940mg [Prunus pe... 75 9e-12 ref|XP_006360538.1| PREDICTED: frataxin, mitochondrial-like [Sol... 74 2e-11 ref|XP_004139965.1| PREDICTED: frataxin, mitochondrial-like [Cuc... 74 2e-11 ref|XP_003624748.1| Frataxin-like protein [Medicago truncatula] ... 74 3e-11 ref|XP_004243423.1| PREDICTED: frataxin, mitochondrial-like [Sol... 72 8e-11 ref|XP_002872789.1| hypothetical protein ARALYDRAFT_490236 [Arab... 72 8e-11 ref|XP_006396553.1| hypothetical protein EUTSA_v10028999mg [Eutr... 72 1e-10 ref|XP_006288733.1| hypothetical protein CARUB_v10002050mg [Caps... 72 1e-10 ref|NP_192233.2| frataxin [Arabidopsis thaliana] gi|83302740|sp|... 72 1e-10 gb|AAD14452.1| putative frataxin-like protein [Arabidopsis thali... 72 1e-10 >ref|XP_002531340.1| Frataxin, mitochondrial precursor, putative [Ricinus communis] gi|223529062|gb|EEF31047.1| Frataxin, mitochondrial precursor, putative [Ricinus communis] Length = 200 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = +1 Query: 205 SGPSRFDWDQNTGAWVYRRTKANLFKVLESELEQLCGQPINLS 333 SGPSR+DWD+N AWVYRRTKANLF+VLESELEQ+CG+PI L+ Sbjct: 158 SGPSRYDWDRNAEAWVYRRTKANLFEVLESELEQVCGEPIKLA 200 >gb|EOX99241.1| Frataxin [Theobroma cacao] Length = 184 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +1 Query: 205 SGPSRFDWDQNTGAWVYRRTKANLFKVLESELEQLCGQPINLS 333 SGPSRFDWD N AWVYRRTKANL K+LESELE+LCG+P+N+S Sbjct: 142 SGPSRFDWDFNAQAWVYRRTKANLLKLLESELEKLCGEPVNIS 184 >ref|XP_006447426.1| hypothetical protein CICLE_v10016814mg [Citrus clementina] gi|567910227|ref|XP_006447427.1| hypothetical protein CICLE_v10016814mg [Citrus clementina] gi|567910229|ref|XP_006447428.1| hypothetical protein CICLE_v10016814mg [Citrus clementina] gi|568831055|ref|XP_006469796.1| PREDICTED: frataxin, mitochondrial-like isoform X1 [Citrus sinensis] gi|568831057|ref|XP_006469797.1| PREDICTED: frataxin, mitochondrial-like isoform X2 [Citrus sinensis] gi|568831059|ref|XP_006469798.1| PREDICTED: frataxin, mitochondrial-like isoform X3 [Citrus sinensis] gi|557550037|gb|ESR60666.1| hypothetical protein CICLE_v10016814mg [Citrus clementina] gi|557550038|gb|ESR60667.1| hypothetical protein CICLE_v10016814mg [Citrus clementina] gi|557550039|gb|ESR60668.1| hypothetical protein CICLE_v10016814mg [Citrus clementina] Length = 196 Score = 78.6 bits (192), Expect = 8e-13 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = +1 Query: 205 SGPSRFDWDQNTGAWVYRRTKANLFKVLESELEQLCGQPINLS 333 SGPSRFDWD WVYRRTKANL K+LESELEQLCG+PINLS Sbjct: 151 SGPSRFDWDTGAQGWVYRRTKANLLKLLESELEQLCGEPINLS 193 >ref|XP_003554058.1| PREDICTED: frataxin, mitochondrial-like [Glycine max] Length = 191 Score = 77.4 bits (189), Expect = 2e-12 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = +1 Query: 205 SGPSRFDWDQNTGAWVYRRTKANLFKVLESELEQLCGQPINLS 333 SGPSRFDWD++T AW+YRR KANL+K+LE E EQLCG+PI+LS Sbjct: 149 SGPSRFDWDRDTKAWIYRRNKANLYKILEGEFEQLCGKPIDLS 191 >ref|XP_003520940.1| PREDICTED: frataxin, mitochondrial-like [Glycine max] Length = 191 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +1 Query: 205 SGPSRFDWDQNTGAWVYRRTKANLFKVLESELEQLCGQPINLS 333 SGPSRFDWD++T AW+YRR KANL+K+LE ELEQLCG+PI LS Sbjct: 149 SGPSRFDWDRDTKAWIYRRNKANLYKILEGELEQLCGKPIVLS 191 >ref|XP_003619899.1| Frataxin-like protein [Medicago truncatula] gi|355494914|gb|AES76117.1| Frataxin-like protein [Medicago truncatula] Length = 188 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +1 Query: 205 SGPSRFDWDQNTGAWVYRRTKANLFKVLESELEQLCGQPINLS 333 SGPSRFDWDQ T AW+YRR KANL+K+LE ELEQLCG+PI LS Sbjct: 146 SGPSRFDWDQVTKAWIYRRNKANLYKILEDELEQLCGKPIVLS 188 >ref|XP_002277091.1| PREDICTED: frataxin, mitochondrial isoform 1 [Vitis vinifera] gi|296081250|emb|CBI17994.3| unnamed protein product [Vitis vinifera] Length = 197 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +1 Query: 205 SGPSRFDWDQNTGAWVYRRTKANLFKVLESELEQLCGQPINLS 333 SGPSRFDWDQ+ AWVYRRTKANL K+LE+ELE+LCG PI+LS Sbjct: 155 SGPSRFDWDQSAQAWVYRRTKANLSKLLETELEKLCGTPISLS 197 >emb|CAN67530.1| hypothetical protein VITISV_004311 [Vitis vinifera] Length = 202 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +1 Query: 205 SGPSRFDWDQNTGAWVYRRTKANLFKVLESELEQLCGQPINLS 333 SGPSRFDWDQ+ AWVYRRTKANL K+LE+ELE+LCG PI+LS Sbjct: 160 SGPSRFDWDQSAQAWVYRRTKANLSKLLETELEKLCGTPISLS 202 >ref|XP_004493241.1| PREDICTED: frataxin, mitochondrial-like [Cicer arietinum] Length = 186 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +1 Query: 205 SGPSRFDWDQNTGAWVYRRTKANLFKVLESELEQLCGQPINLS 333 SGPSRFDWDQ+T AW+YRR KA L+K+LE ELEQLCG+PI LS Sbjct: 144 SGPSRFDWDQDTKAWIYRRNKAKLYKILEVELEQLCGKPIVLS 186 >ref|XP_003619909.1| Frataxin-like protein [Medicago truncatula] gi|355494924|gb|AES76127.1| Frataxin-like protein [Medicago truncatula] Length = 54 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +1 Query: 208 GPSRFDWDQNTGAWVYRRTKANLFKVLESELEQLCGQPINLS 333 GPSRFDWDQ T AW+YRR KANL+K+LE ELEQLCG+PI LS Sbjct: 13 GPSRFDWDQVTKAWIYRRNKANLYKILEDELEQLCGKPIVLS 54 >gb|EMJ18471.1| hypothetical protein PRUPE_ppa011940mg [Prunus persica] Length = 190 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = +1 Query: 205 SGPSRFDWDQNTGAWVYRRTKANLFKVLESELEQLCGQPINLS 333 SGP RFDWD+N AWVYRRTKA+L K+LESE+E+LCG+PI+LS Sbjct: 148 SGPFRFDWDRNAQAWVYRRTKAHLLKLLESEMEELCGEPISLS 190 >ref|XP_006360538.1| PREDICTED: frataxin, mitochondrial-like [Solanum tuberosum] Length = 194 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +1 Query: 205 SGPSRFDWDQNTGAWVYRRTKANLFKVLESELEQLCGQPINLS 333 SGPSRFDWDQ++ W+YRRTKANL KVLE ELE+LCG INLS Sbjct: 152 SGPSRFDWDQSSQGWIYRRTKANLQKVLEDELEKLCGSAINLS 194 >ref|XP_004139965.1| PREDICTED: frataxin, mitochondrial-like [Cucumis sativus] Length = 191 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +1 Query: 205 SGPSRFDWDQNTGAWVYRRTKANLFKVLESELEQLCGQPINLS 333 SGPSRFDWDQN+ W+YRR KANL +LE+EL QLCG+PI+LS Sbjct: 149 SGPSRFDWDQNSQTWIYRRNKANLLSLLETELTQLCGEPIDLS 191 >ref|XP_003624748.1| Frataxin-like protein [Medicago truncatula] gi|355499763|gb|AES80966.1| Frataxin-like protein [Medicago truncatula] Length = 120 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +1 Query: 205 SGPSRFDWDQNTGAWVYRRTKANLFKVLESELEQLCGQPINLS 333 SGPSRFDWDQ T AW+YRR KANL+K+LE ELEQL G+PI LS Sbjct: 78 SGPSRFDWDQVTKAWIYRRNKANLYKILEDELEQLSGKPIVLS 120 >ref|XP_004243423.1| PREDICTED: frataxin, mitochondrial-like [Solanum lycopersicum] Length = 194 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +1 Query: 205 SGPSRFDWDQNTGAWVYRRTKANLFKVLESELEQLCGQPINLS 333 SGPSRFDWDQ++ W+YRRTKANL KVLE ELE+LCG I LS Sbjct: 152 SGPSRFDWDQSSQGWIYRRTKANLQKVLEDELEKLCGSAITLS 194 >ref|XP_002872789.1| hypothetical protein ARALYDRAFT_490236 [Arabidopsis lyrata subsp. lyrata] gi|297318626|gb|EFH49048.1| hypothetical protein ARALYDRAFT_490236 [Arabidopsis lyrata subsp. lyrata] Length = 186 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = +1 Query: 205 SGPSRFDWDQNTGAWVYRRTKANLFKVLESELEQLCGQPINLS 333 SGPSRFDWD++ AW+YRRT+A L K+LE ELE+LCG+PI LS Sbjct: 144 SGPSRFDWDRDANAWIYRRTEAKLHKLLEEELEKLCGEPIQLS 186 >ref|XP_006396553.1| hypothetical protein EUTSA_v10028999mg [Eutrema salsugineum] gi|557097570|gb|ESQ38006.1| hypothetical protein EUTSA_v10028999mg [Eutrema salsugineum] Length = 187 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +1 Query: 205 SGPSRFDWDQNTGAWVYRRTKANLFKVLESELEQLCGQPINLS 333 SGPSRFDWD+ AW+YRRTKA L+K+LE ELE+LCG+ I LS Sbjct: 145 SGPSRFDWDREANAWIYRRTKAKLYKLLEEELEKLCGESIQLS 187 >ref|XP_006288733.1| hypothetical protein CARUB_v10002050mg [Capsella rubella] gi|482557439|gb|EOA21631.1| hypothetical protein CARUB_v10002050mg [Capsella rubella] Length = 186 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +1 Query: 205 SGPSRFDWDQNTGAWVYRRTKANLFKVLESELEQLCGQPINLS 333 SGPSRFDWD++ AW+YRRT+A L K+LE ELE LCG+PI LS Sbjct: 144 SGPSRFDWDRDANAWIYRRTEAKLHKLLEEELENLCGEPIQLS 186 >ref|NP_192233.2| frataxin [Arabidopsis thaliana] gi|83302740|sp|Q9ZR07.2|FRDA_ARATH RecName: Full=Frataxin, mitochondrial; Short=Fxn; Flags: Precursor gi|48958525|gb|AAT47815.1| At4g03240 [Arabidopsis thaliana] gi|51860727|gb|AAU11485.1| mitochondrial frataxin-like [Arabidopsis thaliana] gi|51971038|dbj|BAD44211.1| putative frataxin-like protein [Arabidopsis thaliana] gi|51971859|dbj|BAD44594.1| putative frataxin-like protein [Arabidopsis thaliana] gi|332656896|gb|AEE82296.1| frataxin [Arabidopsis thaliana] Length = 187 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +1 Query: 205 SGPSRFDWDQNTGAWVYRRTKANLFKVLESELEQLCGQPINLS 333 SGPSRFDWD++ AW+YRRT+A L K+LE ELE LCG+PI LS Sbjct: 145 SGPSRFDWDRDANAWIYRRTEAKLHKLLEEELENLCGEPIQLS 187 >gb|AAD14452.1| putative frataxin-like protein [Arabidopsis thaliana] gi|7270194|emb|CAB77809.1| putative frataxin-like protein [Arabidopsis thaliana] Length = 143 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +1 Query: 205 SGPSRFDWDQNTGAWVYRRTKANLFKVLESELEQLCGQPINLS 333 SGPSRFDWD++ AW+YRRT+A L K+LE ELE LCG+PI LS Sbjct: 101 SGPSRFDWDRDANAWIYRRTEAKLHKLLEEELENLCGEPIQLS 143