BLASTX nr result
ID: Rauwolfia21_contig00013564
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00013564 (665 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX92933.1| Uncharacterized protein TCM_001795 [Theobroma cacao] 67 4e-09 ref|XP_003635480.1| PREDICTED: uncharacterized protein LOC100853... 59 2e-06 >gb|EOX92933.1| Uncharacterized protein TCM_001795 [Theobroma cacao] Length = 69 Score = 67.4 bits (163), Expect = 4e-09 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +3 Query: 279 HPQGCRCCYFIWKPQIRCGKVCCGND*C 362 HPQGCRCC+FIWKP IRCGKVCCG+D C Sbjct: 41 HPQGCRCCFFIWKPMIRCGKVCCGDDCC 68 >ref|XP_003635480.1| PREDICTED: uncharacterized protein LOC100853147 [Vitis vinifera] gi|296090665|emb|CBI41065.3| unnamed protein product [Vitis vinifera] Length = 68 Score = 58.5 bits (140), Expect = 2e-06 Identities = 22/33 (66%), Positives = 27/33 (81%), Gaps = 1/33 (3%) Frame = +3 Query: 267 DNTVHPQ-GCRCCYFIWKPQIRCGKVCCGND*C 362 ++ VHPQ GCRCC+FIWKP+I CGK CCG+ C Sbjct: 33 EDMVHPQAGCRCCWFIWKPRISCGKACCGDGCC 65