BLASTX nr result
ID: Rauwolfia21_contig00012217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00012217 (477 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFN53690.1| acyl CoA ligase [Linum usitatissimum] 61 2e-07 ref|XP_004234395.1| PREDICTED: 4-coumarate--CoA ligase-like 10-l... 59 7e-07 ref|XP_006404192.1| hypothetical protein EUTSA_v10010297mg [Eutr... 56 4e-06 ref|XP_002322473.1| AMP-dependent synthetase and ligase family p... 56 4e-06 gb|AGW27197.1| 4-coumarate:coenzyme A ligase 7 [Salvia miltiorrh... 55 7e-06 >gb|AFN53690.1| acyl CoA ligase [Linum usitatissimum] Length = 512 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 372 KHVAGKFPSRRAISVSGKFDLTHLKLDELIERAAS 476 K VAG+FP RRA+SVSGKFDLTH +LDEL+ERAAS Sbjct: 12 KRVAGEFPDRRALSVSGKFDLTHARLDELVERAAS 46 >ref|XP_004234395.1| PREDICTED: 4-coumarate--CoA ligase-like 10-like [Solanum lycopersicum] Length = 523 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 372 KHVAGKFPSRRAISVSGKFDLTHLKLDELIERAAS 476 KHVA KFPSRRAIS SGKFD+TH +L +L+ERAAS Sbjct: 11 KHVAEKFPSRRAISTSGKFDITHARLQQLVERAAS 45 >ref|XP_006404192.1| hypothetical protein EUTSA_v10010297mg [Eutrema salsugineum] gi|557105311|gb|ESQ45645.1| hypothetical protein EUTSA_v10010297mg [Eutrema salsugineum] Length = 514 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 372 KHVAGKFPSRRAISVSGKFDLTHLKLDELIERAAS 476 K+VA KFP RRA+SVSGKFDLTH +L +LIERAAS Sbjct: 11 KNVATKFPDRRALSVSGKFDLTHARLHDLIERAAS 45 >ref|XP_002322473.1| AMP-dependent synthetase and ligase family protein [Populus trichocarpa] gi|222869469|gb|EEF06600.1| AMP-dependent synthetase and ligase family protein [Populus trichocarpa] Length = 524 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +3 Query: 372 KHVAGKFPSRRAISVSGKFDLTHLKLDELIERAAS 476 K VAG+FP+RRA+SVSGK DLTH +L E+IERAAS Sbjct: 11 KRVAGEFPNRRAVSVSGKLDLTHARLHEIIERAAS 45 >gb|AGW27197.1| 4-coumarate:coenzyme A ligase 7 [Salvia miltiorrhiza] Length = 523 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +3 Query: 375 HVAGKFPSRRAISVSGKFDLTHLKLDELIERAAS 476 HVA KFPSRRAISVSGKFDLTH +L++L++ AA+ Sbjct: 12 HVAEKFPSRRAISVSGKFDLTHARLNQLVDHAAA 45