BLASTX nr result
ID: Rauwolfia21_contig00012127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00012127 (368 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281975.1| PREDICTED: nitrate transporter 1.4-like [Vit... 61 2e-07 gb|EOY31045.1| Major facilitator superfamily protein isoform 2 [... 60 2e-07 gb|EOY31044.1| Major facilitator superfamily protein isoform 1 [... 60 2e-07 ref|XP_004288806.1| PREDICTED: nitrate transporter 1.4-like [Fra... 58 1e-06 ref|XP_006600752.1| PREDICTED: nitrate transporter 1.4-like [Gly... 56 4e-06 ref|XP_004508509.1| PREDICTED: nitrate transporter 1.4-like [Cic... 56 4e-06 ref|XP_003609313.1| Nitrate transporter [Medicago truncatula] gi... 56 4e-06 ref|XP_002524480.1| oligopeptide transporter, putative [Ricinus ... 56 4e-06 >ref|XP_002281975.1| PREDICTED: nitrate transporter 1.4-like [Vitis vinifera] Length = 580 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +1 Query: 262 MEGKMGYTAANALDYKGFPADKTKTGGWVASALIL 366 MEGKM +T A+A+DYKGFPAD++KTGGWV +ALIL Sbjct: 1 MEGKMSWTVADAVDYKGFPADRSKTGGWVPAALIL 35 >gb|EOY31045.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao] Length = 581 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = +1 Query: 262 MEGKMGYTAANALDYKGFPADKTKTGGWVASALIL 366 MEGKM +T A+A+DYKGFPAD++KTGGW+ +ALIL Sbjct: 1 MEGKMSWTVADAVDYKGFPADRSKTGGWIPAALIL 35 >gb|EOY31044.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao] Length = 591 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = +1 Query: 262 MEGKMGYTAANALDYKGFPADKTKTGGWVASALIL 366 MEGKM +T A+A+DYKGFPAD++KTGGW+ +ALIL Sbjct: 1 MEGKMSWTVADAVDYKGFPADRSKTGGWIPAALIL 35 >ref|XP_004288806.1| PREDICTED: nitrate transporter 1.4-like [Fragaria vesca subsp. vesca] Length = 617 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +1 Query: 265 EGKMGYTAANALDYKGFPADKTKTGGWVASALIL 366 E KM +TAA+A+DYKGFPADK++TGGWV++ALIL Sbjct: 40 EEKMSWTAADAVDYKGFPADKSRTGGWVSAALIL 73 >ref|XP_006600752.1| PREDICTED: nitrate transporter 1.4-like [Glycine max] Length = 585 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +1 Query: 262 MEGKMGYTAANALDYKGFPADKTKTGGWVASALIL 366 M+ KM +T A+A+DYKGFPAD++KTGGWV +ALIL Sbjct: 1 MKEKMSWTVADAVDYKGFPADRSKTGGWVPAALIL 35 >ref|XP_004508509.1| PREDICTED: nitrate transporter 1.4-like [Cicer arietinum] Length = 581 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 262 MEGKMGYTAANALDYKGFPADKTKTGGWVASALIL 366 ME KM +T +A+DYKGFPAD++KTGGWV +ALIL Sbjct: 1 MEKKMSWTIGDAVDYKGFPADRSKTGGWVTAALIL 35 >ref|XP_003609313.1| Nitrate transporter [Medicago truncatula] gi|355510368|gb|AES91510.1| Nitrate transporter [Medicago truncatula] Length = 577 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 262 MEGKMGYTAANALDYKGFPADKTKTGGWVASALIL 366 ME KM +T +A+DYKGFPAD++KTGGWV +ALIL Sbjct: 1 MEKKMSWTVGDAVDYKGFPADRSKTGGWVPAALIL 35 >ref|XP_002524480.1| oligopeptide transporter, putative [Ricinus communis] gi|223536268|gb|EEF37920.1| oligopeptide transporter, putative [Ricinus communis] Length = 581 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/35 (62%), Positives = 31/35 (88%) Frame = +1 Query: 262 MEGKMGYTAANALDYKGFPADKTKTGGWVASALIL 366 M+GKM + A+A+DYKGFPAD++KTGGW+ +AL+L Sbjct: 1 MDGKMSWAVADAVDYKGFPADRSKTGGWLPAALVL 35