BLASTX nr result
ID: Rauwolfia21_contig00012090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00012090 (979 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004504873.1| PREDICTED: transcription factor GTE7-like is... 57 8e-06 ref|XP_002264867.2| PREDICTED: LOW QUALITY PROTEIN: transcriptio... 57 8e-06 emb|CBI25716.3| unnamed protein product [Vitis vinifera] 57 8e-06 >ref|XP_004504873.1| PREDICTED: transcription factor GTE7-like isoform X1 [Cicer arietinum] Length = 534 Score = 57.4 bits (137), Expect = 8e-06 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = -3 Query: 968 DELPPASEMSGQKNKKWDAGEEDVDIGEEIPVNNFPPVEIEK 843 ++L A G+K KK + G+EDVDIG+++PVNNFPPVEIEK Sbjct: 442 EKLDAAPPSEGKKQKKIETGDEDVDIGDDMPVNNFPPVEIEK 483 >ref|XP_002264867.2| PREDICTED: LOW QUALITY PROTEIN: transcription factor GTE2-like [Vitis vinifera] Length = 499 Score = 57.4 bits (137), Expect = 8e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 938 GQKNKKWDAGEEDVDIGEEIPVNNFPPVEIEK 843 GQKNKK + GEEDVDIGEE+PV++FPPVEI+K Sbjct: 415 GQKNKKGEIGEEDVDIGEEMPVSHFPPVEIDK 446 >emb|CBI25716.3| unnamed protein product [Vitis vinifera] Length = 116 Score = 57.4 bits (137), Expect = 8e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 938 GQKNKKWDAGEEDVDIGEEIPVNNFPPVEIEK 843 GQKNKK + GEEDVDIGEE+PV++FPPVEI+K Sbjct: 32 GQKNKKGEIGEEDVDIGEEMPVSHFPPVEIDK 63