BLASTX nr result
ID: Rauwolfia21_contig00011938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00011938 (443 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269795.1| PREDICTED: mitochondrial import receptor sub... 69 8e-10 ref|XP_006447062.1| hypothetical protein CICLE_v10016720mg [Citr... 68 1e-09 ref|XP_004233293.1| PREDICTED: mitochondrial import receptor sub... 67 3e-09 ref|XP_006338697.1| PREDICTED: mitochondrial import receptor sub... 66 5e-09 gb|EOX99865.1| F17L21.18 isoform 1 [Theobroma cacao] gi|50870797... 65 7e-09 gb|ESW23753.1| hypothetical protein PHAVU_004G072400g [Phaseolus... 65 9e-09 gb|EOX99867.1| F17L21.18 isoform 3 [Theobroma cacao] gi|50870797... 65 9e-09 gb|EMJ19068.1| hypothetical protein PRUPE_ppa021565mg [Prunus pe... 65 9e-09 ref|XP_004159545.1| PREDICTED: mitochondrial import receptor sub... 65 9e-09 ref|XP_004142933.1| PREDICTED: mitochondrial import receptor sub... 65 9e-09 ref|NP_001235550.1| uncharacterized protein LOC100499753 [Glycin... 65 9e-09 ref|XP_006579473.1| PREDICTED: uncharacterized protein LOC100819... 65 1e-08 ref|NP_001241027.1| uncharacterized protein LOC100819858 [Glycin... 65 1e-08 gb|EXC33361.1| Mitochondrial import receptor subunit TOM20 [Moru... 64 2e-08 ref|XP_004145663.1| PREDICTED: mitochondrial import receptor sub... 64 2e-08 ref|NP_001275135.1| mitochondrial import receptor subunit TOM20 ... 64 2e-08 gb|AFK44873.1| unknown [Lotus japonicus] 64 3e-08 ref|XP_006366035.1| PREDICTED: mitochondrial import receptor sub... 63 4e-08 ref|XP_002509514.1| Mitochondrial import receptor subunit TOM20,... 63 4e-08 gb|EOY02797.1| Translocase of outer membrane 20 kDa subunit 3, p... 63 5e-08 >ref|XP_002269795.1| PREDICTED: mitochondrial import receptor subunit TOM20 [Vitis vinifera] gi|296082346|emb|CBI21351.3| unnamed protein product [Vitis vinifera] Length = 201 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 3 QSAKKKKSSDLKYDIFGWIILAVGLVAWVGFTKSH 107 +++KKKKSSDLKYDIFGWIILAVG+VAWVGF KSH Sbjct: 160 KTSKKKKSSDLKYDIFGWIILAVGIVAWVGFAKSH 194 >ref|XP_006447062.1| hypothetical protein CICLE_v10016720mg [Citrus clementina] gi|568831637|ref|XP_006470067.1| PREDICTED: mitochondrial import receptor subunit TOM20-like [Citrus sinensis] gi|557549673|gb|ESR60302.1| hypothetical protein CICLE_v10016720mg [Citrus clementina] Length = 207 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = +3 Query: 3 QSAKKKKSSDLKYDIFGWIILAVGLVAWVGFTKSH 107 +++KKKKSSDLKYDIFGW+ILAVG+VAWVGF KSH Sbjct: 163 KTSKKKKSSDLKYDIFGWVILAVGIVAWVGFAKSH 197 >ref|XP_004233293.1| PREDICTED: mitochondrial import receptor subunit TOM20-like [Solanum lycopersicum] Length = 204 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = +3 Query: 3 QSAKKKKSSDLKYDIFGWIILAVGLVAWVGFTKSH 107 +S+KKKKSSDLKYDIFGW+ILAVG+VAWVGF KS+ Sbjct: 160 KSSKKKKSSDLKYDIFGWVILAVGIVAWVGFAKSN 194 >ref|XP_006338697.1| PREDICTED: mitochondrial import receptor subunit TOM20-like [Solanum tuberosum] Length = 205 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 3 QSAKKKKSSDLKYDIFGWIILAVGLVAWVGFTKSH 107 + +KKKKSSDLKYDIFGW+ILAVGLVAWVGF KS+ Sbjct: 161 KGSKKKKSSDLKYDIFGWVILAVGLVAWVGFAKSN 195 >gb|EOX99865.1| F17L21.18 isoform 1 [Theobroma cacao] gi|508707970|gb|EOX99866.1| F17L21.18 isoform 1 [Theobroma cacao] gi|508707972|gb|EOX99868.1| F17L21.18 isoform 1 [Theobroma cacao] Length = 202 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 6 SAKKKKSSDLKYDIFGWIILAVGLVAWVGFTKSH 107 + KKKKSSDLKYDIFGWIILAVG+VAWVG KSH Sbjct: 162 AVKKKKSSDLKYDIFGWIILAVGIVAWVGMAKSH 195 >gb|ESW23753.1| hypothetical protein PHAVU_004G072400g [Phaseolus vulgaris] Length = 208 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 3 QSAKKKKSSDLKYDIFGWIILAVGLVAWVGFTKSH 107 ++ KKKKSSDLKYDIFGWIILAVG+VAWVGF KS+ Sbjct: 163 KTQKKKKSSDLKYDIFGWIILAVGIVAWVGFAKSN 197 >gb|EOX99867.1| F17L21.18 isoform 3 [Theobroma cacao] gi|508707973|gb|EOX99869.1| F17L21.18 isoform 3 [Theobroma cacao] Length = 199 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 6 SAKKKKSSDLKYDIFGWIILAVGLVAWVGFTKSH 107 +A KKKSSDLKYDIFGWIILAVG+VAWVG KSH Sbjct: 159 TANKKKSSDLKYDIFGWIILAVGIVAWVGMAKSH 192 >gb|EMJ19068.1| hypothetical protein PRUPE_ppa021565mg [Prunus persica] Length = 212 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 QSAKKKKSSDLKYDIFGWIILAVGLVAWVGFTKSH 107 ++ KK KSSDLKYDIFGWIILAVG+VAW+GF KSH Sbjct: 165 KATKKSKSSDLKYDIFGWIILAVGIVAWLGFAKSH 199 >ref|XP_004159545.1| PREDICTED: mitochondrial import receptor subunit TOM20-like [Cucumis sativus] Length = 204 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 9 AKKKKSSDLKYDIFGWIILAVGLVAWVGFTKSH 107 + KKKSSDLKYDIFGW+ILAVG+VAWVG TKSH Sbjct: 165 SSKKKSSDLKYDIFGWVILAVGIVAWVGMTKSH 197 >ref|XP_004142933.1| PREDICTED: mitochondrial import receptor subunit TOM20-like [Cucumis sativus] Length = 204 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 9 AKKKKSSDLKYDIFGWIILAVGLVAWVGFTKSH 107 + KKKSSDLKYDIFGW+ILAVG+VAWVG TKSH Sbjct: 165 SSKKKSSDLKYDIFGWVILAVGIVAWVGMTKSH 197 >ref|NP_001235550.1| uncharacterized protein LOC100499753 [Glycine max] gi|255626295|gb|ACU13492.1| unknown [Glycine max] Length = 209 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 3 QSAKKKKSSDLKYDIFGWIILAVGLVAWVGFTKSH 107 ++ KKKKSSDLKYDIFGWIILAVG+VAWVGF KS+ Sbjct: 165 KTQKKKKSSDLKYDIFGWIILAVGIVAWVGFAKSN 199 >ref|XP_006579473.1| PREDICTED: uncharacterized protein LOC100819858 isoform X1 [Glycine max] Length = 231 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 12 KKKKSSDLKYDIFGWIILAVGLVAWVGFTKSH 107 KKKKSSDLKYDIFGWIILAVG+VAWVGF KS+ Sbjct: 190 KKKKSSDLKYDIFGWIILAVGIVAWVGFAKSN 221 >ref|NP_001241027.1| uncharacterized protein LOC100819858 [Glycine max] gi|255647408|gb|ACU24169.1| unknown [Glycine max] Length = 210 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 12 KKKKSSDLKYDIFGWIILAVGLVAWVGFTKSH 107 KKKKSSDLKYDIFGWIILAVG+VAWVGF KS+ Sbjct: 169 KKKKSSDLKYDIFGWIILAVGIVAWVGFAKSN 200 >gb|EXC33361.1| Mitochondrial import receptor subunit TOM20 [Morus notabilis] Length = 204 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 3 QSAKKKKSSDLKYDIFGWIILAVGLVAWVGFTKSH 107 ++AKKKKSSDLKYDIFGW+ILAV +VAW+G KSH Sbjct: 162 KTAKKKKSSDLKYDIFGWVILAVSIVAWIGLAKSH 196 >ref|XP_004145663.1| PREDICTED: mitochondrial import receptor subunit TOM20-like [Cucumis sativus] gi|449502020|ref|XP_004161521.1| PREDICTED: mitochondrial import receptor subunit TOM20-like [Cucumis sativus] Length = 201 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 6 SAKKKKSSDLKYDIFGWIILAVGLVAWVGFTKSH 107 S KKK SSDLKYD+FGWIILAVGLVAWVGF KS+ Sbjct: 160 STKKKNSSDLKYDLFGWIILAVGLVAWVGFAKSN 193 >ref|NP_001275135.1| mitochondrial import receptor subunit TOM20 [Solanum tuberosum] gi|13631844|sp|P92792.1|TOM20_SOLTU RecName: Full=Mitochondrial import receptor subunit TOM20; AltName: Full=Translocase of outer membrane 20 kDa subunit gi|1524370|emb|CAA63223.1| TOM20 [Solanum tuberosum] Length = 204 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +3 Query: 3 QSAKKKKSSDLKYDIFGWIILAVGLVAWVGFTKSH 107 +S+KK KSSDLKYDIFGW+ILAVG+VAWVGF KS+ Sbjct: 160 KSSKKTKSSDLKYDIFGWVILAVGIVAWVGFAKSN 194 >gb|AFK44873.1| unknown [Lotus japonicus] Length = 207 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 QSAKKKKSSDLKYDIFGWIILAVGLVAWVGFTKSH 107 ++ KKKKSSDLKYDIFGWIILAVG+V WVGF KS+ Sbjct: 165 KTQKKKKSSDLKYDIFGWIILAVGIVTWVGFAKSN 199 >ref|XP_006366035.1| PREDICTED: mitochondrial import receptor subunit TOM20-like [Solanum tuberosum] Length = 203 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +3 Query: 3 QSAKKKKSSDLKYDIFGWIILAVGLVAWVGFTKSH 107 +S+KKKKSSDL +DIFGW+ILAVG+VAWVGF KS+ Sbjct: 161 KSSKKKKSSDLNFDIFGWVILAVGIVAWVGFAKSN 195 >ref|XP_002509514.1| Mitochondrial import receptor subunit TOM20, putative [Ricinus communis] gi|223549413|gb|EEF50901.1| Mitochondrial import receptor subunit TOM20, putative [Ricinus communis] Length = 205 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +3 Query: 3 QSAKKKKSSDLKYDIFGWIILAVGLVAWVGFTKS 104 +++KKKK SDLKYDIFGW+ILAVG+VAW+GF KS Sbjct: 164 KTSKKKKDSDLKYDIFGWVILAVGIVAWIGFAKS 197 >gb|EOY02797.1| Translocase of outer membrane 20 kDa subunit 3, putative [Theobroma cacao] Length = 209 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 6 SAKKKKSSDLKYDIFGWIILAVGLVAWVGFTKS 104 + K KKSSDLKYDIFGWIILAVG+VAWVGF KS Sbjct: 165 ATKNKKSSDLKYDIFGWIILAVGIVAWVGFAKS 197