BLASTX nr result
ID: Rauwolfia21_contig00011893
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00011893 (742 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutr... 82 2e-13 ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum] gi... 80 7e-13 ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuber... 79 2e-12 gb|AAR14052.2| catalase [Solanum tuberosum] 79 2e-12 emb|CCP37650.1| catalase-1 [Nicotiana tabacum] 79 2e-12 gb|AAB62892.1| catalase-1 [Nicotiana glutinosa] 79 2e-12 gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana] 79 2e-12 gb|ACL27272.1| catalase [Nicotiana benthamiana] 79 2e-12 gb|AAB71764.1| catalase 1 [Nicotiana tabacum] 79 2e-12 sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1 gi|5367... 78 3e-12 emb|CCP37651.1| catalase-1 [Nicotiana tabacum] 78 4e-12 ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Popu... 77 8e-12 ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Popu... 77 8e-12 gb|AAD17935.1| catalase [Brassica juncea] 77 8e-12 ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Popu... 77 8e-12 ref|XP_002270703.2| PREDICTED: catalase isozyme 1 isoform 1 [Vit... 76 1e-11 emb|CBI40714.3| unnamed protein product [Vitis vinifera] 76 1e-11 ref|XP_004145541.1| PREDICTED: catalase isozyme 1-like [Cucumis ... 75 2e-11 ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arab... 75 2e-11 ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutr... 75 2e-11 >ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum] gi|557113324|gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum] Length = 518 Score = 81.6 bits (200), Expect = 2e-13 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = +2 Query: 611 LAFTLQAIIKKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 742 L F LQ II+KENNFK+PGERYRSF P+RQERFIRRW+EALSDP Sbjct: 440 LKFVLQCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDP 483 >ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum] gi|17865474|sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 gi|5257185|gb|AAD41256.1| catalase 2 [Solanum lycopersicum] Length = 492 Score = 80.1 bits (196), Expect = 7e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 626 QAIIKKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 742 + II+KENNFKQPGERYRSFTPDRQERFIRRWVEALSDP Sbjct: 419 KCIIQKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 457 >ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum] Length = 492 Score = 79.0 bits (193), Expect = 2e-12 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +2 Query: 626 QAIIKKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 742 + II+KENNFKQPGERYR+FTPDRQERFIRRWVEALSDP Sbjct: 419 KCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDP 457 >gb|AAR14052.2| catalase [Solanum tuberosum] Length = 475 Score = 79.0 bits (193), Expect = 2e-12 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +2 Query: 626 QAIIKKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 742 + II+KENNFKQPGERYR+FTPDRQERFIRRWVEALSDP Sbjct: 402 KCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDP 440 >emb|CCP37650.1| catalase-1 [Nicotiana tabacum] Length = 492 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +2 Query: 626 QAIIKKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 742 + +I+KENNFKQPG+RYRSFTPDRQERFIRRWVEALSDP Sbjct: 419 KCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDP 457 >gb|AAB62892.1| catalase-1 [Nicotiana glutinosa] Length = 492 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +2 Query: 626 QAIIKKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 742 + +I KENNFKQPGERYRSFTPDRQERFIRRWVEALSDP Sbjct: 419 KCVILKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 457 >gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana] Length = 491 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +2 Query: 626 QAIIKKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 742 + +I+KENNFKQPG+RYRSFTPDRQERFIRRWVEALSDP Sbjct: 418 KCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDP 456 >gb|ACL27272.1| catalase [Nicotiana benthamiana] Length = 492 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +2 Query: 626 QAIIKKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 742 + +I+KENNFKQPG+RYRSFTPDRQERFIRRWVEALSDP Sbjct: 419 KCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDP 457 >gb|AAB71764.1| catalase 1 [Nicotiana tabacum] Length = 492 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +2 Query: 626 QAIIKKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 742 + +I+KENNFKQPG+RYRSFTPDRQERFIRRWVEALSDP Sbjct: 419 KCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDP 457 >sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1 gi|536783|emb|CAA85424.1| catalase [Nicotiana plumbaginifolia] Length = 485 Score = 78.2 bits (191), Expect = 3e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +2 Query: 626 QAIIKKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 742 + +I+KENNFKQPGERYRSFTPDRQERFIRRWVE LSDP Sbjct: 412 KCVIQKENNFKQPGERYRSFTPDRQERFIRRWVETLSDP 450 >emb|CCP37651.1| catalase-1 [Nicotiana tabacum] Length = 492 Score = 77.8 bits (190), Expect = 4e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +2 Query: 626 QAIIKKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 742 + +I+KENNF QPGERYRSFTPDRQERFIRRWVEALSDP Sbjct: 419 KCVIQKENNFNQPGERYRSFTPDRQERFIRRWVEALSDP 457 >ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa] gi|550338552|gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa] Length = 490 Score = 76.6 bits (187), Expect = 8e-12 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +2 Query: 626 QAIIKKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 742 + II+KENNFKQPGERYRSF+PDR+ERF+RRWVEALSDP Sbjct: 417 KCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDP 455 >ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa] gi|550338546|gb|ERP60783.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa] Length = 519 Score = 76.6 bits (187), Expect = 8e-12 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +2 Query: 626 QAIIKKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 742 + II+KENNFKQPGERYRSF+PDR+ERF+RRWVEALSDP Sbjct: 419 KCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDP 457 >gb|AAD17935.1| catalase [Brassica juncea] Length = 492 Score = 76.6 bits (187), Expect = 8e-12 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = +2 Query: 626 QAIIKKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 742 + +I+KENNFK+PGERYRSFTP+RQERFIRRW+EALSDP Sbjct: 419 RCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDP 457 >ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa] gi|566170556|ref|XP_006382993.1| catalase family protein [Populus trichocarpa] gi|90818818|emb|CAI43950.1| catalase [Populus deltoides] gi|222855876|gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa] gi|550338553|gb|ERP60790.1| catalase family protein [Populus trichocarpa] Length = 492 Score = 76.6 bits (187), Expect = 8e-12 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +2 Query: 626 QAIIKKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 742 + II+KENNFKQPGERYRSF+PDR+ERF+RRWVEALSDP Sbjct: 419 KCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDP 457 >ref|XP_002270703.2| PREDICTED: catalase isozyme 1 isoform 1 [Vitis vinifera] Length = 560 Score = 75.9 bits (185), Expect = 1e-11 Identities = 41/72 (56%), Positives = 47/72 (65%), Gaps = 11/72 (15%) Frame = +2 Query: 560 KDELINKF----------EHLPFVP*LLAFTLQ-AIIKKENNFKQPGERYRSFTPDRQER 706 +DE +N F E P P +L + II KENNFKQPGERYRSF PDRQER Sbjct: 454 RDEEVNYFPSRYDPVRHAERYPIPPAILTGRREKCIIPKENNFKQPGERYRSFAPDRQER 513 Query: 707 FIRRWVEALSDP 742 FI+RWV+ALSDP Sbjct: 514 FIQRWVDALSDP 525 >emb|CBI40714.3| unnamed protein product [Vitis vinifera] Length = 492 Score = 75.9 bits (185), Expect = 1e-11 Identities = 41/72 (56%), Positives = 47/72 (65%), Gaps = 11/72 (15%) Frame = +2 Query: 560 KDELINKF----------EHLPFVP*LLAFTLQ-AIIKKENNFKQPGERYRSFTPDRQER 706 +DE +N F E P P +L + II KENNFKQPGERYRSF PDRQER Sbjct: 386 RDEEVNYFPSRYDPVRHAERYPIPPAILTGRREKCIIPKENNFKQPGERYRSFAPDRQER 445 Query: 707 FIRRWVEALSDP 742 FI+RWV+ALSDP Sbjct: 446 FIQRWVDALSDP 457 >ref|XP_004145541.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus] gi|449485121|ref|XP_004157075.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus] Length = 973 Score = 75.5 bits (184), Expect = 2e-11 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = +2 Query: 626 QAIIKKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 742 + +I+KENNFK+PGERYRS+TPDRQERFIRRWV+ALSDP Sbjct: 419 RCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDP 457 Score = 68.2 bits (165), Expect = 3e-09 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +2 Query: 626 QAIIKKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 742 + +I+KENNFKQPGERYRS+ DRQERF+ RWV+ALSDP Sbjct: 900 RCVIEKENNFKQPGERYRSWPSDRQERFVGRWVDALSDP 938 >ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. lyrata] gi|297312928|gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. lyrata] Length = 492 Score = 75.5 bits (184), Expect = 2e-11 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = +2 Query: 626 QAIIKKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 742 + II+KENNFK+PGERYRSFTP+RQERFI+RW+EALSDP Sbjct: 419 RCIIEKENNFKEPGERYRSFTPERQERFIQRWIEALSDP 457 >ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum] gi|557113323|gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum] Length = 492 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +2 Query: 626 QAIIKKENNFKQPGERYRSFTPDRQERFIRRWVEALSDP 742 + II+KENNFK+PGERYRSF P+RQERFIRRW+EALSDP Sbjct: 419 RCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDP 457