BLASTX nr result
ID: Rauwolfia21_contig00011799
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00011799 (547 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX92933.1| Uncharacterized protein TCM_001795 [Theobroma cacao] 70 2e-10 ref|XP_003635480.1| PREDICTED: uncharacterized protein LOC100853... 60 3e-07 ref|XP_003594345.1| hypothetical protein MTR_2g027550 [Medicago ... 58 1e-06 >gb|EOX92933.1| Uncharacterized protein TCM_001795 [Theobroma cacao] Length = 69 Score = 70.5 bits (171), Expect = 2e-10 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 251 PQGCRCCFFIWKPQIRCGKVCCGNDCC 171 PQGCRCCFFIWKP IRCGKVCCG+DCC Sbjct: 42 PQGCRCCFFIWKPMIRCGKVCCGDDCC 68 >ref|XP_003635480.1| PREDICTED: uncharacterized protein LOC100853147 [Vitis vinifera] gi|296090665|emb|CBI41065.3| unnamed protein product [Vitis vinifera] Length = 68 Score = 60.1 bits (144), Expect = 3e-07 Identities = 22/33 (66%), Positives = 27/33 (81%), Gaps = 1/33 (3%) Frame = -3 Query: 266 DNTVRPQ-GCRCCFFIWKPQIRCGKVCCGNDCC 171 ++ V PQ GCRCC+FIWKP+I CGK CCG+ CC Sbjct: 33 EDMVHPQAGCRCCWFIWKPRISCGKACCGDGCC 65 >ref|XP_003594345.1| hypothetical protein MTR_2g027550 [Medicago truncatula] gi|355483393|gb|AES64596.1| hypothetical protein MTR_2g027550 [Medicago truncatula] Length = 75 Score = 58.2 bits (139), Expect = 1e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -3 Query: 251 PQGCRCCFFIWKPQIRCGKVCCGNDCC 171 PQGCRCC+FIWKPQI CGKV C CC Sbjct: 49 PQGCRCCWFIWKPQIHCGKVYCEEGCC 75