BLASTX nr result
ID: Rauwolfia21_contig00011657
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00011657 (1464 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006346504.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-07 ref|XP_004230838.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-07 ref|XP_006384483.1| hypothetical protein POPTR_0004s15480g [Popu... 62 8e-07 ref|XP_004292464.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-06 >ref|XP_006346504.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Solanum tuberosum] Length = 618 Score = 63.9 bits (154), Expect = 2e-07 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 1/41 (2%) Frame = +2 Query: 62 GVL-EELLKEMVSKGITPDDSTYISLIEGIGNAEEFLRKKD 181 GVL EELLKEMVSKGITPDDSTY++LIEGIG+ + FL +KD Sbjct: 576 GVLAEELLKEMVSKGITPDDSTYLALIEGIGDVDSFLGRKD 616 >ref|XP_004230838.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Solanum lycopersicum] Length = 618 Score = 63.9 bits (154), Expect = 2e-07 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 1/41 (2%) Frame = +2 Query: 62 GVL-EELLKEMVSKGITPDDSTYISLIEGIGNAEEFLRKKD 181 GVL EELLKEMVSKGITPDDSTY++LIEGIG+ + FL +KD Sbjct: 576 GVLAEELLKEMVSKGITPDDSTYLALIEGIGDVDSFLGRKD 616 >ref|XP_006384483.1| hypothetical protein POPTR_0004s15480g [Populus trichocarpa] gi|550341101|gb|ERP62280.1| hypothetical protein POPTR_0004s15480g [Populus trichocarpa] Length = 524 Score = 61.6 bits (148), Expect = 8e-07 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +2 Query: 71 EELLKEMVSKGITPDDSTYISLIEGIGNAEEFLRKKDP 184 E+LLKEM+SKGITP+D+TY+SLIEGIGN EEFL +P Sbjct: 487 EQLLKEMISKGITPNDNTYLSLIEGIGNVEEFLGISNP 524 >ref|XP_004292464.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 623 Score = 58.9 bits (141), Expect = 5e-06 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +2 Query: 65 VLEELLKEMVSKGITPDDSTYISLIEGIGNAEEFLRK 175 V +ELLKEMVS+GITPDD+TY LIEGI N EEFL+K Sbjct: 584 VAQELLKEMVSRGITPDDNTYYYLIEGIENVEEFLKK 620