BLASTX nr result
ID: Rauwolfia21_contig00011646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00011646 (361 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ16166.1| hypothetical protein PRUPE_ppa001732mg [Prunus pe... 55 7e-06 ref|XP_002320540.2| subtilisin-like protease family protein [Pop... 49 8e-06 gb|ESW25614.1| hypothetical protein PHAVU_003G050900g [Phaseolus... 48 1e-05 >gb|EMJ16166.1| hypothetical protein PRUPE_ppa001732mg [Prunus persica] Length = 773 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = +1 Query: 25 LSLKELVKRKVSSLL*SLQSPNAARDYVFGRLTWSDGKHHVTSPIVVKA 171 L K++ + K LL ++ AA++YVFG+L WSDGKH+V SPIVVKA Sbjct: 724 LEFKKIGEEKSFKLLLQVKDAKAAKNYVFGKLIWSDGKHYVRSPIVVKA 772 >ref|XP_002320540.2| subtilisin-like protease family protein [Populus trichocarpa] gi|550324377|gb|EEE98855.2| subtilisin-like protease family protein [Populus trichocarpa] Length = 769 Score = 48.9 bits (115), Expect(2) = 8e-06 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = +1 Query: 91 AARDYVFGRLTWSDGKHHVTSPIVVK 168 AA+DYVFG L WSD KHHV SPIVVK Sbjct: 742 AAKDYVFGELIWSDNKHHVRSPIVVK 767 Score = 26.2 bits (56), Expect(2) = 8e-06 Identities = 9/17 (52%), Positives = 16/17 (94%) Frame = +3 Query: 24 LEFERIGQEESFKLTLK 74 LEF+++G+E++F +TLK Sbjct: 721 LEFKKVGEEKAFTVTLK 737 >gb|ESW25614.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris] gi|561026975|gb|ESW25615.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris] Length = 778 Score = 47.8 bits (112), Expect(2) = 1e-05 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = +1 Query: 91 AARDYVFGRLTWSDGKHHVTSPIVVKAM 174 A +YVFG+L WSDGKH+V SPIVVKA+ Sbjct: 745 ATNNYVFGKLIWSDGKHYVRSPIVVKAL 772 Score = 26.9 bits (58), Expect(2) = 1e-05 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +3 Query: 21 LLEFERIGQEESFKLTLKLTK 83 +L F ++G+E+ FK+T K+ K Sbjct: 722 ILNFTKVGEEKRFKVTFKIVK 742