BLASTX nr result
ID: Rauwolfia21_contig00011640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00011640 (1204 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006470699.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g... 59 4e-06 ref|XP_006446201.1| hypothetical protein CICLE_v10015410mg [Citr... 59 4e-06 >ref|XP_006470699.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g53840-like [Citrus sinensis] Length = 427 Score = 58.9 bits (141), Expect = 4e-06 Identities = 24/57 (42%), Positives = 39/57 (68%) Frame = +3 Query: 213 INGERINQLPDDLLSEVLSHMALQEAARTSILGRRWRNIRALRLYIDLQMPQHVWNM 383 I+ + IN+LPDD+L ++SH+ L+EAARTS+L RWRN+ ++ + +WN+ Sbjct: 11 ISEDLINRLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTNSLEFDASESLWNV 67 >ref|XP_006446201.1| hypothetical protein CICLE_v10015410mg [Citrus clementina] gi|557548812|gb|ESR59441.1| hypothetical protein CICLE_v10015410mg [Citrus clementina] Length = 412 Score = 58.9 bits (141), Expect = 4e-06 Identities = 24/57 (42%), Positives = 39/57 (68%) Frame = +3 Query: 213 INGERINQLPDDLLSEVLSHMALQEAARTSILGRRWRNIRALRLYIDLQMPQHVWNM 383 I+ + IN+LPDD+L ++SH+ L+EAARTS+L RWRN+ ++ + +WN+ Sbjct: 11 ISEDLINRLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTNSLEFDASESLWNV 67