BLASTX nr result
ID: Rauwolfia21_contig00011590
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00011590 (308 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS62150.1| hypothetical protein M569_12645 [Genlisea aurea] 57 3e-06 >gb|EPS62150.1| hypothetical protein M569_12645 [Genlisea aurea] Length = 167 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 103 MKKVVFKLDFYDDKIKQKAMQRVSGISGVESIA 5 MKKVV KLDF DDKIKQKAMQR+SG+ G+ESIA Sbjct: 1 MKKVVLKLDFSDDKIKQKAMQRISGLPGLESIA 33