BLASTX nr result
ID: Rauwolfia21_contig00011550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00011550 (363 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362154.1| PREDICTED: guanine nucleotide-binding protei... 59 5e-07 ref|XP_004247616.1| PREDICTED: guanine nucleotide-binding protei... 59 5e-07 gb|AGN54390.1| G protein gamma1 subunit, partial [Nicotiana bent... 57 3e-06 >ref|XP_006362154.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Solanum tuberosum] Length = 99 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/39 (84%), Positives = 33/39 (84%), Gaps = 3/39 (7%) Frame = +1 Query: 79 MQSASLEQVRSV---ADTRGKHRISAELKRLEQEARFLE 186 MQS S EQVRSV ADTRGKHRISAELKRLEQE RFLE Sbjct: 1 MQSESSEQVRSVVAAADTRGKHRISAELKRLEQETRFLE 39 >ref|XP_004247616.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Solanum lycopersicum] Length = 99 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/39 (84%), Positives = 33/39 (84%), Gaps = 3/39 (7%) Frame = +1 Query: 79 MQSASLEQVRSV---ADTRGKHRISAELKRLEQEARFLE 186 MQS S EQVRSV ADTRGKHRISAELKRLEQE RFLE Sbjct: 1 MQSESSEQVRSVVAAADTRGKHRISAELKRLEQETRFLE 39 >gb|AGN54390.1| G protein gamma1 subunit, partial [Nicotiana benthamiana] Length = 99 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/39 (79%), Positives = 32/39 (82%), Gaps = 3/39 (7%) Frame = +1 Query: 79 MQSASLEQVRSVA---DTRGKHRISAELKRLEQEARFLE 186 MQS S EQ+RSV DTRGKHRISAELKRLEQE RFLE Sbjct: 1 MQSESSEQLRSVVAATDTRGKHRISAELKRLEQETRFLE 39