BLASTX nr result
ID: Rauwolfia21_contig00010709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00010709 (247 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516301.1| Histone deacetylase, putative [Ricinus commu... 56 4e-06 >ref|XP_002516301.1| Histone deacetylase, putative [Ricinus communis] gi|223544531|gb|EEF46048.1| Histone deacetylase, putative [Ricinus communis] Length = 425 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/72 (37%), Positives = 43/72 (59%), Gaps = 1/72 (1%) Frame = -2 Query: 213 CMWKNCYMLNFYKKNRLPLKHWGLGNGYCLKNIRSLVCCSSS-ANDPTIPSTAETQNAKV 37 CM + + + + R +H +C ++IR+ +CCS+S DP +PS + +A++ Sbjct: 8 CMLSSVQQASLFLRCRHFSQHVMSSRDHCNRSIRACICCSNSFEKDPNLPSIQQLTDARI 67 Query: 36 IYSVASAMGHNQ 1 IYSVA AMGHNQ Sbjct: 68 IYSVAPAMGHNQ 79