BLASTX nr result
ID: Rauwolfia21_contig00010704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00010704 (998 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173390.1| hypothetical protein NitaMp044 [Nicotiana tabac... 95 6e-30 ref|XP_004510058.1| PREDICTED: uncharacterized protein LOC101507... 59 3e-10 ref|XP_003588347.1| NADH-ubiquinone oxidoreductase chain [Medica... 59 3e-10 gb|EXB74570.1| hypothetical protein L484_026267 [Morus notabilis] 63 6e-10 ref|YP_173391.1| hypothetical protein NitaMp045 [Nicotiana tabac... 67 8e-09 >ref|YP_173390.1| hypothetical protein NitaMp044 [Nicotiana tabacum] gi|56806553|dbj|BAD83454.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 222 Score = 94.7 bits (234), Expect(3) = 6e-30 Identities = 53/88 (60%), Positives = 62/88 (70%), Gaps = 1/88 (1%) Frame = +2 Query: 308 ALFFSLLKRVIISITVLSY-PFEL*LGLFFGSQAAFFAPFLTDLLDFLLSAMDRIPLSVG 484 ALFFSLLKR+ +S+TVL P L F +AAFF FL+D LDF LS MDRIPLSVG Sbjct: 17 ALFFSLLKRIFLSLTVLLLTPILLNCNWDFSFEAAFFTSFLSDFLDFWLSLMDRIPLSVG 76 Query: 485 DDRSGASFSKQPSFDLNVPAAEQAVYER 568 D SG S SK+PSFDLN+ AAE+ +R Sbjct: 77 GDGSGPSLSKKPSFDLNISAAEEEPGDR 104 Score = 43.1 bits (100), Expect(3) = 6e-30 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 6/69 (8%) Frame = +1 Query: 571 EIKNQKQTLANLLDPLIKKEAEK------YPDIKKLPSPTDVVEQLIRRIGSNKARAEND 732 +IK QK LA + PLI+ E + + ++ +LPSP+++VE +I R GS A N Sbjct: 118 KIKEQKDLLAEQISPLIESEKARLVRRKWHRNLDELPSPSEMVEIIIDRFGSKAAYNANK 177 Query: 733 HNAPGISRR 759 N P + R Sbjct: 178 PNVPRANLR 186 Score = 41.2 bits (95), Expect(3) = 6e-30 Identities = 18/35 (51%), Positives = 27/35 (77%) Frame = +3 Query: 744 RNLKTWLTRACQNAEDETKGHMSIRSEIRAIIQEY 848 R+L+ WLTRA +AE + KG+MSI++ I +II+ Y Sbjct: 186 RHLRAWLTRAQHSAEQDGKGNMSIKNHISSIIEGY 220 >ref|XP_004510058.1| PREDICTED: uncharacterized protein LOC101507236 [Cicer arietinum] Length = 614 Score = 58.5 bits (140), Expect(2) = 3e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 907 PPPQAELVSRVIGDHFARFGGHLSQPP 987 P PQAELVSRVIGDHFARFGGHLSQPP Sbjct: 54 PTPQAELVSRVIGDHFARFGGHLSQPP 80 Score = 33.9 bits (76), Expect(2) = 3e-10 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +3 Query: 843 EYSQNDSENSLSFPDRRRIIGTPTP 917 + S +D +S PDRRRIIGTPTP Sbjct: 32 DLSADDDVHSWGAPDRRRIIGTPTP 56 >ref|XP_003588347.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477395|gb|AES58598.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 339 Score = 58.5 bits (140), Expect(2) = 3e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 907 PPPQAELVSRVIGDHFARFGGHLSQPP 987 P PQAELVSRVIGDHFARFGGHLSQPP Sbjct: 54 PTPQAELVSRVIGDHFARFGGHLSQPP 80 Score = 33.9 bits (76), Expect(2) = 3e-10 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +3 Query: 843 EYSQNDSENSLSFPDRRRIIGTPTP 917 + S +D +S PDRRRIIGTPTP Sbjct: 32 DLSADDDVHSWGAPDRRRIIGTPTP 56 >gb|EXB74570.1| hypothetical protein L484_026267 [Morus notabilis] Length = 169 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 909 PTPGRVSEPCNRRPFRAVRGALESAAGAR 995 PTPGRVSEPCNRRPFRAVRGALESAAGAR Sbjct: 124 PTPGRVSEPCNRRPFRAVRGALESAAGAR 152 Score = 28.1 bits (61), Expect(2) = 6e-10 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +2 Query: 884 GPPTNNRYPHP 916 GPPTNNRYP P Sbjct: 116 GPPTNNRYPTP 126 >ref|YP_173391.1| hypothetical protein NitaMp045 [Nicotiana tabacum] gi|56806554|dbj|BAD83455.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 102 Score = 67.4 bits (163), Expect = 8e-09 Identities = 43/77 (55%), Positives = 47/77 (61%), Gaps = 1/77 (1%) Frame = -3 Query: 534 LRSKEGCLEKLAPLRSSPTERGILSMAESKKSSKSVRNGAKKAAWL-XXXXXXXXXXXXX 358 LRSKEG +KL PL S PTERGILS+ ES+KS KS+RN KKAA Sbjct: 2 LRSKEGFFDKLGPLPSPPTERGILSIKESQKSRKSLRNEVKKAASKEKSQLQFKRIGVSK 61 Query: 357 STVILIITRFKREKNKA 307 TV L RFKREKNKA Sbjct: 62 RTVRLRKIRFKREKNKA 78