BLASTX nr result
ID: Rauwolfia21_contig00010606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00010606 (332 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61480.1| hypothetical protein VITISV_010931 [Vitis vinife... 58 1e-06 ref|NP_001267815.1| nhx1 antiporter [Vitis vinifera] gi|54645913... 58 1e-06 dbj|BAB11940.1| Na/H antiporter Nhx1 [Atriplex gmelini] gi|54869... 55 7e-06 gb|EOX94940.1| Sodium/hydrogen exchanger isoform 1 [Theobroma ca... 55 7e-06 gb|AAO48271.1| Na/H antiporter Nhx1 [Atriplex dimorphostegia] 55 7e-06 dbj|BAJ06110.1| sodium/proton antiporter [Salsola komarovii] 55 7e-06 gb|ACI16351.1| vacuolar Na+/H+ antiporter [Salsola collina] 55 7e-06 gb|ABU49649.1| Na+/H+ antiporter [Salsola soda] 55 7e-06 gb|EPS58707.1| sodium/hydrogen exchanger, partial [Genlisea aurea] 55 1e-05 emb|CAN99589.1| vacuolar Na+/H+ antiporter [Mesembryanthemum cry... 55 1e-05 >emb|CAN61480.1| hypothetical protein VITISV_010931 [Vitis vinifera] gi|297736919|emb|CBI26120.3| unnamed protein product [Vitis vinifera] Length = 541 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 232 LYYMQFTRAGYTQLRGNSIMITSTISVVLFSTV 330 L Y QFTRAG+TQLRGN+IMITSTISVVLFSTV Sbjct: 400 LAYNQFTRAGHTQLRGNAIMITSTISVVLFSTV 432 >ref|NP_001267815.1| nhx1 antiporter [Vitis vinifera] gi|54645913|gb|AAV36562.1| nhx1 antiporter [Vitis vinifera] Length = 541 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 232 LYYMQFTRAGYTQLRGNSIMITSTISVVLFSTV 330 L Y QFTRAG+TQLRGN+IMITSTISVVLFSTV Sbjct: 400 LAYNQFTRAGHTQLRGNAIMITSTISVVLFSTV 432 >dbj|BAB11940.1| Na/H antiporter Nhx1 [Atriplex gmelini] gi|548691666|gb|AGX13726.1| Na+/H+ antiporter [synthetic construct] Length = 555 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 232 LYYMQFTRAGYTQLRGNSIMITSTISVVLFSTV 330 L Y QFTR+G+TQLRGN+IMITSTISVVLFST+ Sbjct: 401 LAYNQFTRSGHTQLRGNAIMITSTISVVLFSTM 433 >gb|EOX94940.1| Sodium/hydrogen exchanger isoform 1 [Theobroma cacao] gi|508703045|gb|EOX94941.1| Sodium/hydrogen exchanger isoform 1 [Theobroma cacao] Length = 524 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 232 LYYMQFTRAGYTQLRGNSIMITSTISVVLFSTV 330 L Y QFTR+G+TQLRGN+IMITSTI+VVLFSTV Sbjct: 387 LAYNQFTRSGHTQLRGNAIMITSTITVVLFSTV 419 >gb|AAO48271.1| Na/H antiporter Nhx1 [Atriplex dimorphostegia] Length = 555 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 232 LYYMQFTRAGYTQLRGNSIMITSTISVVLFSTV 330 L Y QFTR+G+TQLRGN+IMITSTISVVLFST+ Sbjct: 401 LAYNQFTRSGHTQLRGNAIMITSTISVVLFSTM 433 >dbj|BAJ06110.1| sodium/proton antiporter [Salsola komarovii] Length = 559 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 232 LYYMQFTRAGYTQLRGNSIMITSTISVVLFSTV 330 L Y QFTRAG+TQLRGN+IMITSTI+VVLFST+ Sbjct: 401 LAYNQFTRAGHTQLRGNAIMITSTITVVLFSTM 433 >gb|ACI16351.1| vacuolar Na+/H+ antiporter [Salsola collina] Length = 457 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 232 LYYMQFTRAGYTQLRGNSIMITSTISVVLFSTV 330 L Y QFTRAG+TQLRGN+IMITSTI+VVLFST+ Sbjct: 299 LAYNQFTRAGHTQLRGNAIMITSTITVVLFSTM 331 >gb|ABU49649.1| Na+/H+ antiporter [Salsola soda] Length = 559 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 232 LYYMQFTRAGYTQLRGNSIMITSTISVVLFSTV 330 L Y QFTRAG+TQLRGN+IMITSTI+VVLFST+ Sbjct: 401 LAYNQFTRAGHTQLRGNAIMITSTITVVLFSTM 433 >gb|EPS58707.1| sodium/hydrogen exchanger, partial [Genlisea aurea] Length = 421 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +1 Query: 232 LYYMQFTRAGYTQLRGNSIMITSTISVVLFSTV 330 L Y QFTRAG+TQLRGN+++ITSTI+VVLFSTV Sbjct: 388 LAYKQFTRAGHTQLRGNALLITSTITVVLFSTV 420 >emb|CAN99589.1| vacuolar Na+/H+ antiporter [Mesembryanthemum crystallinum] Length = 556 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 232 LYYMQFTRAGYTQLRGNSIMITSTISVVLFSTV 330 L Y QFTRAG+TQLRGN+IMITSTISVVL STV Sbjct: 401 LAYNQFTRAGHTQLRGNAIMITSTISVVLVSTV 433