BLASTX nr result
ID: Rauwolfia21_contig00010343
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00010343 (1878 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006371275.1| LUC7 N terminus domain-containing family pro... 61 1e-06 ref|XP_002325908.1| hypothetical protein POPTR_0019s08260g [Popu... 59 6e-06 ref|XP_002328961.1| predicted protein [Populus trichocarpa] 59 6e-06 ref|XP_006428636.1| hypothetical protein CICLE_v10012249mg [Citr... 59 1e-05 >ref|XP_006371275.1| LUC7 N terminus domain-containing family protein [Populus trichocarpa] gi|550317006|gb|ERP49072.1| LUC7 N terminus domain-containing family protein [Populus trichocarpa] Length = 315 Score = 61.2 bits (147), Expect = 1e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 1827 DRRLADHFGGKLHLGYMQIREKLSELQVLL 1738 DRRLADHFGGKLHLGYMQIREKL+ELQVL+ Sbjct: 286 DRRLADHFGGKLHLGYMQIREKLTELQVLV 315 >ref|XP_002325908.1| hypothetical protein POPTR_0019s08260g [Populus trichocarpa] gi|222862783|gb|EEF00290.1| hypothetical protein POPTR_0019s08260g [Populus trichocarpa] Length = 326 Score = 59.3 bits (142), Expect = 6e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -1 Query: 1827 DRRLADHFGGKLHLGYMQIREKLSELQV 1744 DRRLADHFGGKLHLGYMQIREKL+ELQV Sbjct: 286 DRRLADHFGGKLHLGYMQIREKLTELQV 313 >ref|XP_002328961.1| predicted protein [Populus trichocarpa] Length = 312 Score = 59.3 bits (142), Expect = 6e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -1 Query: 1827 DRRLADHFGGKLHLGYMQIREKLSELQV 1744 DRRLADHFGGKLHLGYMQIREKL+ELQV Sbjct: 285 DRRLADHFGGKLHLGYMQIREKLTELQV 312 >ref|XP_006428636.1| hypothetical protein CICLE_v10012249mg [Citrus clementina] gi|567872099|ref|XP_006428639.1| hypothetical protein CICLE_v10012249mg [Citrus clementina] gi|557530693|gb|ESR41876.1| hypothetical protein CICLE_v10012249mg [Citrus clementina] gi|557530696|gb|ESR41879.1| hypothetical protein CICLE_v10012249mg [Citrus clementina] Length = 314 Score = 58.5 bits (140), Expect = 1e-05 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 1827 DRRLADHFGGKLHLGYMQIREKLSELQVLL 1738 DRRLADHFGGKLHLGYMQIR+KL+ELQ L+ Sbjct: 285 DRRLADHFGGKLHLGYMQIRDKLAELQALV 314