BLASTX nr result
ID: Rauwolfia21_contig00010236
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00010236 (392 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534747.1| conserved hypothetical protein [Ricinus comm... 62 1e-07 >ref|XP_002534747.1| conserved hypothetical protein [Ricinus communis] gi|255604001|ref|XP_002538152.1| conserved hypothetical protein [Ricinus communis] gi|223513575|gb|EEF24232.1| conserved hypothetical protein [Ricinus communis] gi|223524644|gb|EEF27638.1| conserved hypothetical protein [Ricinus communis] Length = 126 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/41 (75%), Positives = 34/41 (82%), Gaps = 3/41 (7%) Frame = -2 Query: 115 GGDSPHLHS--MEELLLNPHYNKKKCSPDRY-MMLNRDRDR 2 GG SPHLHS MEE LLNPHYN+ + SPDRY MMLNRD+DR Sbjct: 10 GGGSPHLHSHSMEEQLLNPHYNQSQFSPDRYMMMLNRDQDR 50