BLASTX nr result
ID: Rauwolfia21_contig00008965
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00008965 (468 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006490120.1| PREDICTED: ribosomal RNA small subunit methy... 55 7e-06 >ref|XP_006490120.1| PREDICTED: ribosomal RNA small subunit methyltransferase NEP1-like [Citrus sinensis] Length = 294 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = -2 Query: 467 IGAMAHGEIDSDGRDDLISVSALPLSAGICVRRICIELECARNIL 333 +GAMAHG+ID D DDLI++S PLSA C+ RIC LE N+L Sbjct: 250 VGAMAHGKIDCDYTDDLIAISGYPLSAACCIARICEALEDKWNLL 294