BLASTX nr result
ID: Rauwolfia21_contig00007762
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00007762 (596 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY09341.1| Exostosin family protein isoform 1 [Theobroma cac... 58 2e-06 ref|XP_002526728.1| catalytic, putative [Ricinus communis] gi|22... 57 4e-06 ref|XP_006493901.1| PREDICTED: uncharacterized protein LOC102626... 56 6e-06 ref|XP_006421449.1| hypothetical protein CICLE_v10004353mg [Citr... 56 6e-06 ref|XP_002308967.2| exostosin family protein [Populus trichocarp... 56 8e-06 emb|CBI29877.3| unnamed protein product [Vitis vinifera] 56 8e-06 ref|XP_002277596.1| PREDICTED: uncharacterized protein LOC100267... 56 8e-06 >gb|EOY09341.1| Exostosin family protein isoform 1 [Theobroma cacao] gi|508717445|gb|EOY09342.1| Exostosin family protein isoform 1 [Theobroma cacao] Length = 794 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 594 VLHYKLHNDPWRRELAPLKEDFGVPEECRIYT 499 VLHYKLHNDPWRR+LA LK+++GVP EC I T Sbjct: 762 VLHYKLHNDPWRRQLAHLKKEYGVPPECLIRT 793 >ref|XP_002526728.1| catalytic, putative [Ricinus communis] gi|223533917|gb|EEF35642.1| catalytic, putative [Ricinus communis] Length = 728 Score = 57.0 bits (136), Expect = 4e-06 Identities = 21/28 (75%), Positives = 27/28 (96%) Frame = -3 Query: 594 VLHYKLHNDPWRRELAPLKEDFGVPEEC 511 +LHYKLHNDPWRR+L+ LK+DFG+P+EC Sbjct: 697 ILHYKLHNDPWRRQLSHLKKDFGLPQEC 724 >ref|XP_006493901.1| PREDICTED: uncharacterized protein LOC102626477 isoform X1 [Citrus sinensis] Length = 791 Score = 56.2 bits (134), Expect = 6e-06 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -3 Query: 594 VLHYKLHNDPWRRELAPLKEDFGVPEEC 511 +LHYKLHNDPWRREL K+DFG+P+EC Sbjct: 763 ILHYKLHNDPWRRELVHQKKDFGIPQEC 790 >ref|XP_006421449.1| hypothetical protein CICLE_v10004353mg [Citrus clementina] gi|557523322|gb|ESR34689.1| hypothetical protein CICLE_v10004353mg [Citrus clementina] Length = 791 Score = 56.2 bits (134), Expect = 6e-06 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -3 Query: 594 VLHYKLHNDPWRRELAPLKEDFGVPEEC 511 +LHYKLHNDPWRREL K+DFG+P+EC Sbjct: 763 ILHYKLHNDPWRRELVHQKKDFGIPQEC 790 >ref|XP_002308967.2| exostosin family protein [Populus trichocarpa] gi|550335517|gb|EEE92490.2| exostosin family protein [Populus trichocarpa] Length = 793 Score = 55.8 bits (133), Expect = 8e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -3 Query: 594 VLHYKLHNDPWRRELAPLKEDFGVPEECRIYT 499 VLHYKLHNDPWRR+L K+DFG+P+EC + T Sbjct: 761 VLHYKLHNDPWRRQLGSQKKDFGLPQECLMRT 792 >emb|CBI29877.3| unnamed protein product [Vitis vinifera] Length = 822 Score = 55.8 bits (133), Expect = 8e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -3 Query: 594 VLHYKLHNDPWRRELAPLKEDFGVPEECRIYT 499 VLHYKLHNDPWR++LA LK+DFG+ +EC I T Sbjct: 790 VLHYKLHNDPWRQQLAHLKKDFGLAQECLIRT 821 >ref|XP_002277596.1| PREDICTED: uncharacterized protein LOC100267584 [Vitis vinifera] Length = 794 Score = 55.8 bits (133), Expect = 8e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -3 Query: 594 VLHYKLHNDPWRRELAPLKEDFGVPEECRIYT 499 VLHYKLHNDPWR++LA LK+DFG+ +EC I T Sbjct: 762 VLHYKLHNDPWRQQLAHLKKDFGLAQECLIRT 793