BLASTX nr result
ID: Rauwolfia21_contig00007621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00007621 (1689 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG52236.1|AC011717_4 putative DnaJ protein; 34157-30943 [Ara... 59 5e-06 gb|AAD55462.1|AC009322_2 Hypothetical protein [Arabidopsis thali... 59 5e-06 >gb|AAG52236.1|AC011717_4 putative DnaJ protein; 34157-30943 [Arabidopsis thaliana] Length = 702 Score = 59.3 bits (142), Expect = 5e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 1687 MTIIPRTPQGHGWLRPAIGVVELSQCLIQV 1598 M +IPRT QGHGWLRPA+GVVELSQC++QV Sbjct: 343 MAVIPRTAQGHGWLRPAVGVVELSQCIVQV 372 >gb|AAD55462.1|AC009322_2 Hypothetical protein [Arabidopsis thaliana] Length = 719 Score = 59.3 bits (142), Expect = 5e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 1687 MTIIPRTPQGHGWLRPAIGVVELSQCLIQV 1598 M +IPRT QGHGWLRPA+GVVELSQC++QV Sbjct: 360 MAVIPRTAQGHGWLRPAVGVVELSQCIVQV 389