BLASTX nr result
ID: Rauwolfia21_contig00007491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00007491 (551 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006473064.1| PREDICTED: G-box-binding factor 4-like isofo... 56 5e-06 ref|XP_006434468.1| hypothetical protein CICLE_v10002059mg [Citr... 56 5e-06 >ref|XP_006473064.1| PREDICTED: G-box-binding factor 4-like isoform X1 [Citrus sinensis] Length = 291 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -1 Query: 551 KVERTKERHKLLLEKVIPVVEKRRPARKLRRICSAIW 441 K ERTKER+K L+EKV+PVVEK+RP R LRR+ SA W Sbjct: 255 KAERTKERYKQLMEKVVPVVEKKRPPRVLRRVQSAEW 291 >ref|XP_006434468.1| hypothetical protein CICLE_v10002059mg [Citrus clementina] gi|557536590|gb|ESR47708.1| hypothetical protein CICLE_v10002059mg [Citrus clementina] Length = 290 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -1 Query: 551 KVERTKERHKLLLEKVIPVVEKRRPARKLRRICSAIW 441 K ERTKER+K L+EKV+PVVEK+RP R LRR+ SA W Sbjct: 254 KAERTKERYKQLMEKVVPVVEKKRPPRVLRRVQSAEW 290