BLASTX nr result
ID: Rauwolfia21_contig00007305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00007305 (306 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB05871.2| PAPS-reductase-like protein [Catharanthus roseus] 58 1e-06 >gb|AAB05871.2| PAPS-reductase-like protein [Catharanthus roseus] Length = 464 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 213 AATHFGSFQPLDRPHTISTSVNVSRRRLAVK 305 AA FGSFQPLDRPHTIS SVNVSRRRLAVK Sbjct: 25 AAAQFGSFQPLDRPHTISPSVNVSRRRLAVK 55