BLASTX nr result
ID: Rauwolfia21_contig00007173
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00007173 (653 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006858059.1| hypothetical protein AMTR_s00062p00045770 [A... 58 3e-06 gb|ESW14246.1| hypothetical protein PHAVU_008G265300g [Phaseolus... 57 4e-06 ref|XP_006366045.1| PREDICTED: septum-promoting GTP-binding prot... 57 5e-06 ref|XP_004244140.1| PREDICTED: septum-promoting GTP-binding prot... 57 5e-06 gb|ESW18407.1| hypothetical protein PHAVU_006G038400g [Phaseolus... 56 8e-06 ref|XP_003533896.1| PREDICTED: septum-promoting GTP-binding prot... 56 8e-06 ref|XP_003519565.1| PREDICTED: septum-promoting GTP-binding prot... 56 8e-06 gb|ACU24471.1| unknown [Glycine max] 56 8e-06 >ref|XP_006858059.1| hypothetical protein AMTR_s00062p00045770 [Amborella trichopoda] gi|548862162|gb|ERN19526.1| hypothetical protein AMTR_s00062p00045770 [Amborella trichopoda] Length = 107 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 653 QSAIPILIGTKFDDFAQLPPDIQWTVISQV 564 Q+AIPILIGTKFDDF LPPDIQWT+++QV Sbjct: 72 QTAIPILIGTKFDDFVHLPPDIQWTIVNQV 101 >gb|ESW14246.1| hypothetical protein PHAVU_008G265300g [Phaseolus vulgaris] Length = 279 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -1 Query: 653 QSAIPILIGTKFDDFAQLPPDIQWTVISQ 567 QSAIPILIGTKFDDF +LPPD+QWT+++Q Sbjct: 197 QSAIPILIGTKFDDFVRLPPDVQWTIVTQ 225 >ref|XP_006366045.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Solanum tuberosum] Length = 289 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -1 Query: 653 QSAIPILIGTKFDDFAQLPPDIQWTVISQ 567 Q+AIPILIGTKFDDF QLPPDIQW+V++Q Sbjct: 207 QTAIPILIGTKFDDFVQLPPDIQWSVVTQ 235 >ref|XP_004244140.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Solanum lycopersicum] Length = 289 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -1 Query: 653 QSAIPILIGTKFDDFAQLPPDIQWTVISQ 567 Q+AIPILIGTKFDDF QLPPDIQW+V++Q Sbjct: 207 QTAIPILIGTKFDDFVQLPPDIQWSVVTQ 235 >gb|ESW18407.1| hypothetical protein PHAVU_006G038400g [Phaseolus vulgaris] Length = 279 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/29 (75%), Positives = 28/29 (96%) Frame = -1 Query: 653 QSAIPILIGTKFDDFAQLPPDIQWTVISQ 567 Q+AIPILIGTKFDDF +LPPD+QWT+++Q Sbjct: 197 QTAIPILIGTKFDDFVRLPPDVQWTIVTQ 225 >ref|XP_003533896.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Glycine max] Length = 310 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/29 (75%), Positives = 28/29 (96%) Frame = -1 Query: 653 QSAIPILIGTKFDDFAQLPPDIQWTVISQ 567 Q+AIPILIGTKFDDF +LPPD+QWT+++Q Sbjct: 228 QTAIPILIGTKFDDFVKLPPDVQWTIVTQ 256 >ref|XP_003519565.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Glycine max] Length = 282 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/29 (75%), Positives = 28/29 (96%) Frame = -1 Query: 653 QSAIPILIGTKFDDFAQLPPDIQWTVISQ 567 Q+AIPILIGTKFDDF +LPPD+QWT+++Q Sbjct: 200 QTAIPILIGTKFDDFVRLPPDVQWTIVTQ 228 >gb|ACU24471.1| unknown [Glycine max] Length = 289 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/29 (75%), Positives = 28/29 (96%) Frame = -1 Query: 653 QSAIPILIGTKFDDFAQLPPDIQWTVISQ 567 Q+AIPILIGTKFDDF +LPPD+QWT+++Q Sbjct: 207 QTAIPILIGTKFDDFVKLPPDVQWTIVTQ 235