BLASTX nr result
ID: Rauwolfia21_contig00006373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00006373 (337 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ20000.1| hypothetical protein PRUPE_ppa009820mg [Prunus pe... 67 2e-09 gb|ESW11641.1| hypothetical protein PHAVU_008G047400g, partial [... 65 1e-08 ref|XP_002770925.1| RAS small GTpases RIC1/ypt1, putative [Perki... 64 2e-08 gb|EXC02066.1| Ras-related protein RABD2c [Morus notabilis] 63 5e-08 ref|XP_006911133.1| PREDICTED: ras-related protein Rab-1B [Ptero... 63 5e-08 ref|XP_006860957.1| PREDICTED: ras-related protein Rab-1B isofor... 63 5e-08 ref|XP_006893362.1| PREDICTED: ras-related protein Rab-1B isofor... 63 5e-08 ref|XP_006893361.1| PREDICTED: ras-related protein Rab-1B isofor... 63 5e-08 ref|XP_006771625.1| PREDICTED: ras-related protein Rab-1B [Myoti... 63 5e-08 ref|NP_001265926.1| ras-related protein RABD2c-like [Cicer ariet... 63 5e-08 sp|P10536.1|RAB1B_RAT RecName: Full=Ras-related protein Rab-1B g... 63 5e-08 dbj|BAA02117.1| GTP-binding protein [Pisum sativum] gi|738941|pr... 63 5e-08 gb|AAB28535.1| ras-related GTP binding protein possessing GTPase... 63 5e-08 prf||1515250A rab1B protein 63 5e-08 sp|P22125.1|RAB1_DISOM RecName: Full=Ras-related protein ORAB-1 ... 63 5e-08 ref|XP_002906462.1| Rab1 family GTPase (PiYpt1) [Phytophthora in... 63 5e-08 ref|NP_001047606.2| Os02g0653800 [Oryza sativa Japonica Group] g... 63 5e-08 ref|NP_083852.1| ras-related protein Rab-1B [Mus musculus] gi|35... 63 5e-08 ref|NP_001105441.1| GTP-binding protein YPTM2 [Zea mays] gi|4661... 63 5e-08 ref|XP_001225498.1| GTP-binding protein ypt1 [Chaetomium globosu... 63 5e-08 >gb|EMJ20000.1| hypothetical protein PRUPE_ppa009820mg [Prunus persica] Length = 276 Score = 67.4 bits (163), Expect = 2e-09 Identities = 42/80 (52%), Positives = 54/80 (67%), Gaps = 9/80 (11%) Frame = +1 Query: 124 LALLVLTPAATISFTLDF*PPERRIPAR--SPW---ISLAFSIYPP----IMNPEYDYLF 276 L+L + + + ++F+ F PPE + +R S W I + F + P +MNPEYDYLF Sbjct: 25 LSLSLSSSSLPLAFSKAF-PPENQSWSRLCSGWTGPIPVEFFVDQPLAVTVMNPEYDYLF 83 Query: 277 KLLLIGDSGVGKSCLLLRFA 336 KLLLIGDSGVGKSCLLLRFA Sbjct: 84 KLLLIGDSGVGKSCLLLRFA 103 >gb|ESW11641.1| hypothetical protein PHAVU_008G047400g, partial [Phaseolus vulgaris] Length = 281 Score = 64.7 bits (156), Expect = 1e-08 Identities = 35/48 (72%), Positives = 37/48 (77%), Gaps = 2/48 (4%) Frame = +1 Query: 199 PARSPW--ISLAFSIYPPIMNPEYDYLFKLLLIGDSGVGKSCLLLRFA 336 PA SP ++L S MNPEYDYLFKLLLIGDSGVGKSCLLLRFA Sbjct: 61 PAASPRSPVNLRSSFSSLEMNPEYDYLFKLLLIGDSGVGKSCLLLRFA 108 >ref|XP_002770925.1| RAS small GTpases RIC1/ypt1, putative [Perkinsus marinus ATCC 50983] gi|239874051|gb|EER02741.1| RAS small GTpases RIC1/ypt1, putative [Perkinsus marinus ATCC 50983] Length = 211 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 247 IMNPEYDYLFKLLLIGDSGVGKSCLLLRFA 336 IMNPEYDYLFKLLLIGDSGVGKSCLLLRFA Sbjct: 5 IMNPEYDYLFKLLLIGDSGVGKSCLLLRFA 34 >gb|EXC02066.1| Ras-related protein RABD2c [Morus notabilis] Length = 202 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 250 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 336 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA Sbjct: 1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 29 >ref|XP_006911133.1| PREDICTED: ras-related protein Rab-1B [Pteropus alecto] Length = 201 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 250 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 336 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA Sbjct: 1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 29 >ref|XP_006860957.1| PREDICTED: ras-related protein Rab-1B isoform X1 [Chrysochloris asiatica] Length = 201 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 250 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 336 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA Sbjct: 1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 29 >ref|XP_006893362.1| PREDICTED: ras-related protein Rab-1B isoform X2 [Elephantulus edwardii] Length = 125 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 250 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 336 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA Sbjct: 1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 29 >ref|XP_006893361.1| PREDICTED: ras-related protein Rab-1B isoform X1 [Elephantulus edwardii] Length = 201 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 250 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 336 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA Sbjct: 1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 29 >ref|XP_006771625.1| PREDICTED: ras-related protein Rab-1B [Myotis davidii] Length = 239 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 250 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 336 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA Sbjct: 39 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 67 >ref|NP_001265926.1| ras-related protein RABD2c-like [Cicer arietinum] gi|4586580|dbj|BAA76422.1| rab-type small GTP-binding protein [Cicer arietinum] Length = 202 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 250 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 336 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA Sbjct: 1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 29 >sp|P10536.1|RAB1B_RAT RecName: Full=Ras-related protein Rab-1B gi|57006|emb|CAA32105.1| unnamed protein product [Rattus sp.] Length = 201 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 250 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 336 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA Sbjct: 1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 29 >dbj|BAA02117.1| GTP-binding protein [Pisum sativum] gi|738941|prf||2001457J GTP-binding protein Length = 203 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 250 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 336 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA Sbjct: 1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 29 >gb|AAB28535.1| ras-related GTP binding protein possessing GTPase activity [Oryza sativa] Length = 202 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 250 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 336 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA Sbjct: 1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 29 >prf||1515250A rab1B protein Length = 201 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 250 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 336 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA Sbjct: 1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 29 >sp|P22125.1|RAB1_DISOM RecName: Full=Ras-related protein ORAB-1 gi|213123|gb|AAA49234.1| GTP-binding protein [Discopyge ommata] Length = 202 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 250 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 336 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA Sbjct: 1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 29 >ref|XP_002906462.1| Rab1 family GTPase (PiYpt1) [Phytophthora infestans T30-4] gi|2500076|sp|Q01890.1|YPT1_PHYIN RecName: Full=Ras-like GTP-binding protein YPT1 gi|940432|gb|AAB40355.1| ras related protein PiYpt1 [Phytophthora infestans] gi|262107811|gb|EEY65863.1| Rab1 family GTPase (PiYpt1) [Phytophthora infestans T30-4] gi|348688420|gb|EGZ28234.1| hypothetical protein PHYSODRAFT_309136 [Phytophthora sojae] gi|566017605|gb|ETI40516.1| Ras-like GTP-binding protein YPT1 [Phytophthora parasitica P1569] gi|566017606|gb|ETI40517.1| Ras-like GTP-binding protein YPT1, variant [Phytophthora parasitica P1569] gi|567954984|gb|ETK80617.1| Ras-like GTP-binding protein YPT1 [Phytophthora parasitica] gi|567954985|gb|ETK80618.1| Ras-like GTP-binding protein YPT1, variant [Phytophthora parasitica] gi|567983653|gb|ETL34040.1| Ras-like GTP-binding protein YPT1 [Phytophthora parasitica] gi|567983654|gb|ETL34041.1| Ras-like GTP-binding protein YPT1, variant [Phytophthora parasitica] gi|568013139|gb|ETL87316.1| Ras-like GTP-binding protein YPT1 [Phytophthora parasitica] gi|568013140|gb|ETL87317.1| Ras-like GTP-binding protein YPT1, variant [Phytophthora parasitica] gi|568043247|gb|ETM40542.1| Ras-like GTP-binding protein YPT1 [Phytophthora parasitica] gi|568043248|gb|ETM40543.1| Ras-like GTP-binding protein YPT1, variant [Phytophthora parasitica] gi|568090340|gb|ETN05175.1| Ras-like GTP-binding protein YPT1 [Phytophthora parasitica INRA-310] gi|568090341|gb|ETN05176.1| Ras-like GTP-binding protein YPT1, variant [Phytophthora parasitica INRA-310] gi|570321301|gb|ETO69249.1| Ras-like GTP-binding protein YPT1 [Phytophthora parasitica P1976] gi|570321302|gb|ETO69250.1| Ras-like GTP-binding protein YPT1, variant [Phytophthora parasitica P1976] gi|570945035|gb|ETP10292.1| Ras-like GTP-binding protein YPT1 [Phytophthora parasitica CJ01A1] gi|570945036|gb|ETP10293.1| Ras-like GTP-binding protein YPT1, variant [Phytophthora parasitica CJ01A1] gi|570976666|gb|ETP38434.1| Ras-like GTP-binding protein YPT1 [Phytophthora parasitica P10297] gi|570976667|gb|ETP38435.1| Ras-like GTP-binding protein YPT1, variant [Phytophthora parasitica P10297] Length = 201 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 250 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 336 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA Sbjct: 1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 29 >ref|NP_001047606.2| Os02g0653800 [Oryza sativa Japonica Group] gi|14140133|emb|CAC39050.1| putative GTP-binding protein [Oryza sativa] gi|49387522|dbj|BAD24987.1| putative GTP-binding protein YPTM2 [Oryza sativa Japonica Group] gi|215769313|dbj|BAH01542.1| unnamed protein product [Oryza sativa Japonica Group] gi|222623360|gb|EEE57492.1| hypothetical protein OsJ_07768 [Oryza sativa Japonica Group] gi|255671140|dbj|BAF09520.2| Os02g0653800 [Oryza sativa Japonica Group] Length = 203 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 250 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 336 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA Sbjct: 1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 29 >ref|NP_083852.1| ras-related protein Rab-1B [Mus musculus] gi|354494718|ref|XP_003509482.1| PREDICTED: ras-related protein Rab-1B-like [Cricetulus griseus] gi|532016010|ref|XP_005351768.1| PREDICTED: ras-related protein Rab-1B isoform X1 [Microtus ochrogaster] gi|46577116|sp|Q9D1G1.1|RAB1B_MOUSE RecName: Full=Ras-related protein Rab-1B gi|12834379|dbj|BAB22888.1| unnamed protein product [Mus musculus] gi|16741106|gb|AAH16408.1| RAB1B, member RAS oncogene family [Mus musculus] gi|74140247|dbj|BAE33821.1| unnamed protein product [Mus musculus] gi|112292937|dbj|BAF02846.1| Rab1B [Mus musculus] gi|148701158|gb|EDL33105.1| RAB1B, member RAS oncogene family, isoform CRA_c [Mus musculus] gi|344243245|gb|EGV99348.1| Ras-related protein Rab-1B [Cricetulus griseus] Length = 201 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 250 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 336 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA Sbjct: 1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 29 >ref|NP_001105441.1| GTP-binding protein YPTM2 [Zea mays] gi|466172|sp|Q05737.1|YPTM2_MAIZE RecName: Full=GTP-binding protein YPTM2 gi|287835|emb|CAA44919.1| yptm2 [Zea mays] Length = 203 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 250 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 336 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA Sbjct: 1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 29 >ref|XP_001225498.1| GTP-binding protein ypt1 [Chaetomium globosum CBS 148.51] gi|88179121|gb|EAQ86589.1| GTP-binding protein ypt1 [Chaetomium globosum CBS 148.51] Length = 203 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 250 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 336 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA Sbjct: 1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFA 29