BLASTX nr result
ID: Rauwolfia21_contig00006018
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00006018 (670 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533538.1| Multidrug resistance protein, putative [Rici... 84 3e-14 gb|EPS68961.1| hypothetical protein M569_05805, partial [Genlise... 80 6e-13 ref|XP_002324121.2| hypothetical protein POPTR_0017s13110g [Popu... 79 1e-12 gb|EOY03715.1| Transporter associated with antigen processing pr... 79 1e-12 emb|CBI21202.3| unnamed protein product [Vitis vinifera] 57 5e-06 >ref|XP_002533538.1| Multidrug resistance protein, putative [Ricinus communis] gi|223526588|gb|EEF28841.1| Multidrug resistance protein, putative [Ricinus communis] Length = 644 Score = 84.3 bits (207), Expect = 3e-14 Identities = 43/65 (66%), Positives = 52/65 (80%) Frame = -2 Query: 195 MGRKQHLDWTSRSIMSTGSERVSLLNKKAKQKADEDASSNAPLTDLEHGDAVPAANVQFS 16 MG+KQ+LDWTSRSI S+GSERVSLL+K+A++KA+ED S + DLE GD V AANV F Sbjct: 1 MGKKQNLDWTSRSISSSGSERVSLLSKEARRKANEDQSPDGSPNDLELGDGVEAANVGFG 60 Query: 15 RVFLL 1 RVF L Sbjct: 61 RVFSL 65 >gb|EPS68961.1| hypothetical protein M569_05805, partial [Genlisea aurea] Length = 649 Score = 80.1 bits (196), Expect = 6e-13 Identities = 42/65 (64%), Positives = 50/65 (76%) Frame = -2 Query: 195 MGRKQHLDWTSRSIMSTGSERVSLLNKKAKQKADEDASSNAPLTDLEHGDAVPAANVQFS 16 MG+KQHLDWTS+SIMS+GSERVSLLNK ++K ++DA + TDLE G AV ANV FS Sbjct: 1 MGKKQHLDWTSKSIMSSGSERVSLLNK--QRKVNDDAEGDESKTDLEQGGAVEPANVGFS 58 Query: 15 RVFLL 1 RV L Sbjct: 59 RVIRL 63 >ref|XP_002324121.2| hypothetical protein POPTR_0017s13110g [Populus trichocarpa] gi|550320188|gb|EEF04254.2| hypothetical protein POPTR_0017s13110g [Populus trichocarpa] Length = 645 Score = 79.0 bits (193), Expect = 1e-12 Identities = 42/66 (63%), Positives = 51/66 (77%), Gaps = 1/66 (1%) Frame = -2 Query: 195 MGRKQHLDWTSRSIMSTGSERVSLL-NKKAKQKADEDASSNAPLTDLEHGDAVPAANVQF 19 MG+K++LDWTSRSI S+GSERVSLL +K AK+K++E S + P TDLE G AANV F Sbjct: 1 MGKKEYLDWTSRSISSSGSERVSLLTSKDAKRKSNEGESPDGPATDLELGGGTEAANVGF 60 Query: 18 SRVFLL 1 SRVF L Sbjct: 61 SRVFAL 66 >gb|EOY03715.1| Transporter associated with antigen processing protein 2 [Theobroma cacao] Length = 644 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/65 (58%), Positives = 48/65 (73%) Frame = -2 Query: 195 MGRKQHLDWTSRSIMSTGSERVSLLNKKAKQKADEDASSNAPLTDLEHGDAVPAANVQFS 16 MG+KQHLDWTS+SI S+GS RV LL K+ ++A++ S N P++DLE GDA ANV F Sbjct: 1 MGKKQHLDWTSKSISSSGSNRVPLLYKEKSKQANDHQSPNGPVSDLEQGDAAEVANVGFC 60 Query: 15 RVFLL 1 RVF L Sbjct: 61 RVFSL 65 >emb|CBI21202.3| unnamed protein product [Vitis vinifera] Length = 1265 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/57 (54%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = -2 Query: 168 TSRSIMSTGSE-RVSLLNKKAKQKADEDASSNAPLTDLEHGDAVPAANVQFSRVFLL 1 TS+ M++GSE LLNK+A++K ++D ++N PLTDLE GDA AA V F RVF L Sbjct: 630 TSKPNMASGSESNAPLLNKEAEKKPNDDQAANDPLTDLERGDADQAAKVGFFRVFFL 686