BLASTX nr result
ID: Rauwolfia21_contig00005885
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00005885 (523 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAH59409.1| hypothetical protein [Plantago major] 60 4e-07 gb|EPS74477.1| hypothetical protein M569_00288 [Genlisea aurea] 59 9e-07 ref|XP_004252338.1| PREDICTED: translation machinery-associated ... 57 3e-06 >emb|CAH59409.1| hypothetical protein [Plantago major] Length = 63 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 381 MSSKQGGKAKPLKQPKSEKKEYDEVDKAFI 292 MSSKQGGKAKPLKQPKSEKKEYDE+DKA I Sbjct: 1 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 30 >gb|EPS74477.1| hypothetical protein M569_00288 [Genlisea aurea] Length = 64 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 381 MSSKQGGKAKPLKQPKSEKKEYDEVDKAFI 292 MSSKQGGKAKPLKQPK+EKKEYDE+DKA I Sbjct: 1 MSSKQGGKAKPLKQPKAEKKEYDEIDKANI 30 >ref|XP_004252338.1| PREDICTED: translation machinery-associated protein 7-like [Solanum lycopersicum] Length = 63 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 381 MSSKQGGKAKPLKQPKSEKKEYDEVDKAFI 292 MSSKQGGKAKPLK PK+EKKEYDE DKAF+ Sbjct: 1 MSSKQGGKAKPLKAPKTEKKEYDENDKAFL 30