BLASTX nr result
ID: Rauwolfia21_contig00005874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00005874 (769 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004935597.1| ycf15 protein (chloroplast) [Eleutherococcus... 117 6e-24 sp|Q68RU5.1|YCF15_PANGI RecName: Full=Putative uncharacterized p... 115 2e-23 gb|ADZ36339.1| hypothetical protein RF15 [Franklinia alatamaha] 66 3e-23 prf||1211235CB ORF 87 66 7e-23 ref|YP_004891652.1| ycf15 gene product (chloroplast) [Nicotiana ... 65 2e-22 ref|YP_007317293.1| Ycf15 (chloroplast) [Camellia sinensis] gi|4... 66 2e-22 ref|YP_007507156.1| ycf15 protein (chloroplast) [Salvia miltiorr... 64 3e-22 gb|AFV61857.1| Ycf15 (chloroplast) [Origanum vulgare subsp. vulg... 64 3e-22 ref|YP_004935711.1| ycf15 gene product (chloroplast) [Sesamum in... 66 5e-22 ref|YP_007353976.1| Ycf15 protein (chloroplast) [Tectona grandis... 64 5e-22 sp|Q06GJ8.1|YCF15_PIPCE RecName: Full=Putative uncharacterized p... 66 6e-22 sp|Q33BV4.1|YCF15_NICTO RecName: Full=Putative uncharacterized p... 65 6e-22 ref|YP_008563133.1| hypothetical chloroplast RF15 (chloroplast) ... 65 8e-22 gb|ADZ36326.1| hypothetical protein RF15 [Camellia obtusifolia] 65 2e-21 ref|YP_008081310.1| hypothetical chloroplast RF15 (chloroplast) ... 69 8e-21 gb|ADZ36362.1| hypothetical protein RF15 [Symplocos paniculata] 64 1e-20 ref|YP_004940553.1| ycf15 gene product (chloroplast) [Boea hygro... 61 1e-20 ref|YP_008082625.1| hypothetical chloroplast RF15 (chloroplast) ... 60 6e-20 ref|YP_007890283.1| Ycf15 protein (chloroplast) [Cistanche deser... 60 2e-19 sp|P68941.1|YCF15_OENPI RecName: Full=Putative uncharacterized p... 55 3e-16 >ref|YP_004935597.1| ycf15 protein (chloroplast) [Eleutherococcus senticosus] gi|359422209|ref|YP_004935614.1| ycf15 protein (chloroplast) [Eleutherococcus senticosus] gi|558602956|ref|YP_008814988.1| hypothetical chloroplast RF15 (chloroplast) [Brassaiopsis hainla] gi|558602975|ref|YP_008815005.1| hypothetical chloroplast RF15 (chloroplast) [Brassaiopsis hainla] gi|558603044|ref|YP_008815075.1| hypothetical chloroplast RF15 (chloroplast) [Metapanax delavayi] gi|558603063|ref|YP_008815092.1| hypothetical chloroplast RF15 (chloroplast) [Metapanax delavayi] gi|558603132|ref|YP_008815162.1| hypothetical chloroplast RF15 (chloroplast) [Schefflera delavayi] gi|558603151|ref|YP_008815179.1| hypothetical chloroplast RF15 (chloroplast) [Schefflera delavayi] gi|563940429|ref|YP_008815249.1| hypothetical chloroplast RF15 (chloroplast) [Kalopanax septemlobus] gi|563940448|ref|YP_008815266.1| hypothetical chloroplast RF15 (chloroplast) [Kalopanax septemlobus] gi|347448271|gb|AEO92683.1| ycf15 protein (chloroplast) [Eleutherococcus senticosus] gi|347448272|gb|AEO92684.1| ycf15 protein (chloroplast) [Eleutherococcus senticosus] gi|458599236|gb|AGG39087.1| hypothetical chloroplast RF15 (chloroplast) [Brassaiopsis hainla] gi|458599255|gb|AGG39106.1| hypothetical chloroplast RF15 (chloroplast) [Brassaiopsis hainla] gi|458599415|gb|AGG39174.1| hypothetical chloroplast RF15 (chloroplast) [Metapanax delavayi] gi|458599434|gb|AGG39193.1| hypothetical chloroplast RF15 (chloroplast) [Metapanax delavayi] gi|458599568|gb|AGG39261.1| hypothetical chloroplast RF15 (chloroplast) [Schefflera delavayi] gi|458599587|gb|AGG39280.1| hypothetical chloroplast RF15 (chloroplast) [Schefflera delavayi] gi|458599656|gb|AGG39348.1| hypothetical chloroplast RF15 (chloroplast) [Kalopanax septemlobus] gi|458599675|gb|AGG39367.1| hypothetical chloroplast RF15 (chloroplast) [Kalopanax septemlobus] Length = 100 Score = 117 bits (292), Expect = 6e-24 Identities = 64/102 (62%), Positives = 70/102 (68%) Frame = +1 Query: 166 VETLVSSIFWTLAPWNNMLLLKHGRIEIVDQNXXXXXXXXXXXXXEQRTTSSNIHDQEVL 345 +ETLVSSIFWTLAPWNNMLLLKHGRIEI+DQN +I + Sbjct: 1 METLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKK- 59 Query: 346 NSLLFRIEVLKGEGRLECQQASIVEFTRPDSTHFGNVQCQSH 471 S FRI + EGRLECQQASI+EFTRPDSTHFGNVQCQSH Sbjct: 60 RSTGFRIGP-ESEGRLECQQASIIEFTRPDSTHFGNVQCQSH 100 >sp|Q68RU5.1|YCF15_PANGI RecName: Full=Putative uncharacterized protein ycf15 gi|51235357|gb|AAT98553.1| ycf15 protein [Panax ginseng] gi|51235376|gb|AAT98572.1| ycf15 protein [Panax ginseng] gi|506444470|gb|AGM15032.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gi|506444471|gb|AGM15033.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gi|506444558|gb|AGM15118.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gi|506444559|gb|AGM15119.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gi|506444674|gb|AGM15204.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gi|506444675|gb|AGM15205.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] Length = 100 Score = 115 bits (288), Expect = 2e-23 Identities = 63/102 (61%), Positives = 70/102 (68%) Frame = +1 Query: 166 VETLVSSIFWTLAPWNNMLLLKHGRIEIVDQNXXXXXXXXXXXXXEQRTTSSNIHDQEVL 345 +ETLVSSIFWTLAPWNNMLLLKHGRIEI++QN +I + Sbjct: 1 METLVSSIFWTLAPWNNMLLLKHGRIEILEQNTMYGWYELPKQEFLNSEQPVHIFTTKK- 59 Query: 346 NSLLFRIEVLKGEGRLECQQASIVEFTRPDSTHFGNVQCQSH 471 S FRI + EGRLECQQASI+EFTRPDSTHFGNVQCQSH Sbjct: 60 RSTGFRIGP-ESEGRLECQQASIIEFTRPDSTHFGNVQCQSH 100 >gb|ADZ36339.1| hypothetical protein RF15 [Franklinia alatamaha] Length = 82 Score = 66.2 bits (160), Expect(3) = 3e-23 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +1 Query: 166 VETLVSSIFWTLAPWNNMLLLKHGRIEIVDQN 261 +ETL+SSIFWTLAPWNNMLLLKHGRIEI+DQN Sbjct: 1 METLLSSIFWTLAPWNNMLLLKHGRIEILDQN 32 Score = 53.5 bits (127), Expect(3) = 3e-23 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 275 YERPKQEFVNSEQPVQIFTTKKY*ILFSFG 364 YE PKQEF+NSEQPVQIFTTKKY ILF G Sbjct: 38 YELPKQEFLNSEQPVQIFTTKKYWILFRIG 67 Score = 36.2 bits (82), Expect(3) = 3e-23 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +3 Query: 369 GPERRRKAGMPTGVY 413 GPERRRKAGMPTGVY Sbjct: 67 GPERRRKAGMPTGVY 81 >prf||1211235CB ORF 87 Length = 87 Score = 66.2 bits (160), Expect(3) = 7e-23 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 166 VETLVSSIFWTLAPWNNMLLLKHGRIEIVDQN 261 VETLVSSIFWTLAPW NMLLLKHGRIEI+DQN Sbjct: 1 VETLVSSIFWTLAPWKNMLLLKHGRIEILDQN 32 Score = 52.0 bits (123), Expect(3) = 7e-23 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 275 YERPKQEFVNSEQPVQIFTTKKY*ILFSFG 364 YE PKQEF+NS+QPVQIFTTKKY ILF G Sbjct: 38 YELPKQEFLNSKQPVQIFTTKKYWILFRIG 67 Score = 36.2 bits (82), Expect(3) = 7e-23 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +3 Query: 369 GPERRRKAGMPTGVY 413 GPERRRKAGMPTGVY Sbjct: 67 GPERRRKAGMPTGVY 81 >ref|YP_004891652.1| ycf15 gene product (chloroplast) [Nicotiana undulata] gi|351653957|ref|YP_004891684.1| ycf15 gene product (chloroplast) [Nicotiana undulata] gi|394831164|ref|YP_006503853.1| hypothetical chloroplast RF15 (chloroplast) [Datura stramonium] gi|404474569|ref|YP_006666074.1| Ycf15 protein (chloroplast) [Capsicum annuum] gi|404474586|ref|YP_006666091.1| Ycf15 protein (chloroplast) [Capsicum annuum] gi|122201807|sp|Q2MIE3.1|YCF15_SOLBU RecName: Full=Putative uncharacterized protein ycf15 gi|122209875|sp|Q2VED6.1|YCF15_SOLTU RecName: Full=Putative uncharacterized protein ycf15 gi|122213578|sp|Q3C1N3.1|YCF15_NICSY RecName: Full=Putative uncharacterized protein ycf15 gi|4388759|emb|CAA77386.1| Ycf15 protein [Nicotiana tabacum] gi|4388763|emb|CAA77407.1| hypothetical protein [Nicotiana tabacum] gi|77799610|dbj|BAE46699.1| Ycf15 protein [Nicotiana sylvestris] gi|77799643|dbj|BAE46732.1| Ycf15 protein [Nicotiana sylvestris] gi|82754668|gb|ABB90082.1| ycf15 protein [Solanum tuberosum] gi|82754684|gb|ABB90098.1| ycf15 protein [Solanum tuberosum] gi|84371939|gb|ABC56257.1| hypothetical chloroplast RF15 [Solanum bulbocastanum] gi|84371958|gb|ABC56276.1| hypothetical chloroplast RF15 [Solanum bulbocastanum] gi|88656847|gb|ABD47100.1| hypothetical chloroplast RF15 [Solanum tuberosum] gi|88656865|gb|ABD47118.1| hypothetical chloroplast RF15 [Solanum tuberosum] gi|329124626|gb|AEB72183.1| hypothetical chloroplast RF15 (chloroplast) [Solanum tuberosum] gi|329124643|gb|AEB72200.1| hypothetical chloroplast RF15 (chloroplast) [Solanum tuberosum] gi|329124713|gb|AEB72269.1| hypothetical chloroplast RF15 (chloroplast) [Solanum tuberosum] gi|329124730|gb|AEB72286.1| hypothetical chloroplast RF15 (chloroplast) [Solanum tuberosum] gi|347453955|gb|AEO95613.1| hypothetical chloroplast RF15 (chloroplast) [Nicotiana undulata] gi|347453983|gb|AEO95641.1| hypothetical chloroplast RF15 (chloroplast) [Nicotiana undulata] gi|347454066|gb|AEO95723.1| hypothetical chloroplast RF15 [synthetic construct] gi|347454092|gb|AEO95749.1| hypothetical chloroplast RF15 [synthetic construct] gi|350996487|gb|AEQ36999.1| hypothetical chloroplast RF15 (chloroplast) [Datura stramonium] gi|350996575|gb|AEQ37086.1| hypothetical chloroplast RF15 [Datura stramonium] gi|401065976|gb|AFP90820.1| Ycf15 protein (chloroplast) [Capsicum annuum] gi|401065993|gb|AFP90837.1| Ycf15 protein (chloroplast) [Capsicum annuum] Length = 87 Score = 65.1 bits (157), Expect(3) = 2e-22 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 166 VETLVSSIFWTLAPWNNMLLLKHGRIEIVDQN 261 +ETLVSSIFWTLAPW NMLLLKHGRIEI+DQN Sbjct: 1 METLVSSIFWTLAPWKNMLLLKHGRIEILDQN 32 Score = 52.0 bits (123), Expect(3) = 2e-22 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 275 YERPKQEFVNSEQPVQIFTTKKY*ILFSFG 364 YE PKQEF+NS+QPVQIFTTKKY ILF G Sbjct: 38 YELPKQEFLNSKQPVQIFTTKKYWILFRIG 67 Score = 36.2 bits (82), Expect(3) = 2e-22 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +3 Query: 369 GPERRRKAGMPTGVY 413 GPERRRKAGMPTGVY Sbjct: 67 GPERRRKAGMPTGVY 81 >ref|YP_007317293.1| Ycf15 (chloroplast) [Camellia sinensis] gi|435856435|ref|YP_007317310.1| Ycf15 (chloroplast) [Camellia sinensis] gi|542688173|ref|YP_008520184.1| Ycf15 (chloroplast) [Camellia taliensis] gi|542688174|ref|YP_008520203.1| Ycf15 (chloroplast) [Camellia taliensis] gi|552539647|ref|YP_008592802.1| Ycf15 (chloroplast) [Camellia cuspidata] gi|552539648|ref|YP_008592821.1| Ycf15 (chloroplast) [Camellia cuspidata] gi|552540895|ref|YP_008592888.1| Ycf15 (chloroplast) [Camellia danzaiensis] gi|552540896|ref|YP_008592908.1| Ycf15 (chloroplast) [Camellia danzaiensis] gi|552540989|ref|YP_008592978.1| Ycf15 (chloroplast) [Camellia impressinervis] gi|552540990|ref|YP_008592997.1| Ycf15 (chloroplast) [Camellia impressinervis] gi|552541083|ref|YP_008593156.1| Ycf15 (chloroplast) [Camellia yunnanensis] gi|552541084|ref|YP_008593175.1| Ycf15 (chloroplast) [Camellia yunnanensis] gi|552546242|ref|YP_008593067.1| Ycf15 (chloroplast) [Camellia pitardii] gi|552546243|ref|YP_008593086.1| Ycf15 (chloroplast) [Camellia pitardii] gi|568244603|ref|YP_008963350.1| hypothetical chloroplast RF15 [Camellia oleifera] gi|568244622|ref|YP_008963369.1| hypothetical chloroplast RF15 [Camellia oleifera] gi|388893251|gb|AFK81343.1| hypothetical chloroplast RF15 [Camellia sinensis var. assamica] gi|388893270|gb|AFK81362.1| hypothetical chloroplast RF15 [Camellia sinensis var. assamica] gi|388893339|gb|AFK81430.1| hypothetical chloroplast RF15 [Camellia oleifera] gi|388893358|gb|AFK81449.1| hypothetical chloroplast RF15 [Camellia oleifera] gi|388893427|gb|AFK81517.1| hypothetical chloroplast RF15 [Camellia taliensis] gi|388893446|gb|AFK81536.1| hypothetical chloroplast RF15 [Camellia taliensis] gi|430728317|gb|AGA55641.1| Ycf15 (chloroplast) [Camellia sinensis] gi|430728334|gb|AGA55658.1| Ycf15 (chloroplast) [Camellia sinensis] gi|537362465|gb|AGU44273.1| Ycf15 (chloroplast) [Camellia cuspidata] gi|537362466|gb|AGU44274.1| Ycf15 (chloroplast) [Camellia cuspidata] gi|537362554|gb|AGU44361.1| Ycf15 (chloroplast) [Camellia danzaiensis] gi|537362555|gb|AGU44362.1| Ycf15 (chloroplast) [Camellia danzaiensis] gi|537362643|gb|AGU44449.1| Ycf15 (chloroplast) [Camellia impressinervis] gi|537362644|gb|AGU44450.1| Ycf15 (chloroplast) [Camellia impressinervis] gi|537362733|gb|AGU44538.1| Ycf15 (chloroplast) [Camellia taliensis] gi|537362734|gb|AGU44539.1| Ycf15 (chloroplast) [Camellia taliensis] gi|537362823|gb|AGU44627.1| Ycf15 (chloroplast) [Camellia pitardii] gi|537362824|gb|AGU44628.1| Ycf15 (chloroplast) [Camellia pitardii] gi|537362913|gb|AGU44716.1| Ycf15 (chloroplast) [Camellia yunnanensis] gi|537362914|gb|AGU44717.1| Ycf15 (chloroplast) [Camellia yunnanensis] gi|537363003|gb|AGU44805.1| Ycf15 (chloroplast) [Camellia taliensis] gi|537363004|gb|AGU44806.1| Ycf15 (chloroplast) [Camellia taliensis] gi|555945960|gb|AGZ19187.1| hypothetical chloroplast RF15 (chloroplast) [Camellia sinensis] Length = 82 Score = 66.2 bits (160), Expect(3) = 2e-22 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +1 Query: 166 VETLVSSIFWTLAPWNNMLLLKHGRIEIVDQN 261 +ETL+SSIFWTLAPWNNMLLLKHGRIEI+DQN Sbjct: 1 METLLSSIFWTLAPWNNMLLLKHGRIEILDQN 32 Score = 53.5 bits (127), Expect(3) = 2e-22 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 275 YERPKQEFVNSEQPVQIFTTKKY*ILFSFG 364 YE PKQEF+NSEQPVQIFTTKKY ILF G Sbjct: 38 YELPKQEFLNSEQPVQIFTTKKYWILFRIG 67 Score = 33.1 bits (74), Expect(3) = 2e-22 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +3 Query: 369 GPERRRKAGMPTGVY 413 G ERRRKAGMPTGVY Sbjct: 67 GSERRRKAGMPTGVY 81 >ref|YP_007507156.1| ycf15 protein (chloroplast) [Salvia miltiorrhiza] gi|459014555|ref|YP_007507173.1| ycf15 protein (chloroplast) [Salvia miltiorrhiza] gi|401879786|gb|AFQ30973.1| ycf15 protein (chloroplast) [Salvia miltiorrhiza] gi|401879805|gb|AFQ30992.1| ycf15 protein (chloroplast) [Salvia miltiorrhiza] gi|573461996|emb|CCQ71665.1| Ycf15 (chloroplast) [Salvia miltiorrhiza] gi|573462015|emb|CCQ71684.1| Ycf15 (chloroplast) [Salvia miltiorrhiza] Length = 82 Score = 64.3 bits (155), Expect(3) = 3e-22 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 166 VETLVSSIFWTLAPWNNMLLLKHGRIEIVDQN 261 +ETL+SSIFWTL PWNNMLLLKHGRIEI+DQN Sbjct: 1 METLLSSIFWTLPPWNNMLLLKHGRIEILDQN 32 Score = 53.5 bits (127), Expect(3) = 3e-22 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 275 YERPKQEFVNSEQPVQIFTTKKY*ILFSFG 364 YE PKQEF+NSEQPVQIFTTKKY ILF G Sbjct: 38 YELPKQEFLNSEQPVQIFTTKKYWILFRIG 67 Score = 34.7 bits (78), Expect(3) = 3e-22 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +3 Query: 369 GPERRRKAGMPTGVY 413 GPERRRK GMPTGVY Sbjct: 67 GPERRRKGGMPTGVY 81 >gb|AFV61857.1| Ycf15 (chloroplast) [Origanum vulgare subsp. vulgare] gi|410176215|gb|AFV61874.1| Ycf15 (chloroplast) [Origanum vulgare subsp. vulgare] Length = 82 Score = 64.3 bits (155), Expect(3) = 3e-22 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 166 VETLVSSIFWTLAPWNNMLLLKHGRIEIVDQN 261 +ETL+SSIFWTL PWNNMLLLKHGRIEI+DQN Sbjct: 1 METLLSSIFWTLPPWNNMLLLKHGRIEILDQN 32 Score = 53.1 bits (126), Expect(3) = 3e-22 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 275 YERPKQEFVNSEQPVQIFTTKKY*ILFSFG 364 YE PKQEF+NSEQPVQIFTTKKY ILF G Sbjct: 38 YELPKQEFLNSEQPVQIFTTKKYWILFRVG 67 Score = 34.7 bits (78), Expect(3) = 3e-22 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +3 Query: 369 GPERRRKAGMPTGVY 413 GPERRRK GMPTGVY Sbjct: 67 GPERRRKGGMPTGVY 81 >ref|YP_004935711.1| ycf15 gene product (chloroplast) [Sesamum indicum] gi|359422323|ref|YP_004935728.1| ycf15 gene product (chloroplast) [Sesamum indicum] gi|347448340|gb|AEO92751.1| ycf15 protein (chloroplast) [Sesamum indicum] gi|347448357|gb|AEO92768.1| ycf15 protein (chloroplast) [Sesamum indicum] gi|496538645|gb|AGL45380.1| Ycf15 (chloroplast) [Sesamum indicum] Length = 82 Score = 66.2 bits (160), Expect(3) = 5e-22 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +1 Query: 166 VETLVSSIFWTLAPWNNMLLLKHGRIEIVDQN 261 +ETL+SSIFWTLAPWNNMLLLKHGRIEI+DQN Sbjct: 1 METLLSSIFWTLAPWNNMLLLKHGRIEILDQN 32 Score = 53.5 bits (127), Expect(3) = 5e-22 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 275 YERPKQEFVNSEQPVQIFTTKKY*ILFSFG 364 YE PKQEF+NSEQPVQIFTTKKY ILF G Sbjct: 38 YELPKQEFLNSEQPVQIFTTKKYWILFRIG 67 Score = 32.0 bits (71), Expect(3) = 5e-22 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 369 GPERRRKAGMPTGVY 413 GPERRRK GMPT VY Sbjct: 67 GPERRRKGGMPTDVY 81 >ref|YP_007353976.1| Ycf15 protein (chloroplast) [Tectona grandis] gi|438687665|emb|CCP47195.1| ycf15 protein (chloroplast) [Tectona grandis] gi|438688349|emb|CCP47284.1| ycf15 protein (chloroplast) [Tectona grandis] gi|438688473|emb|CCP47373.1| ycf15 protein (chloroplast) [Tectona grandis] Length = 82 Score = 63.5 bits (153), Expect(3) = 5e-22 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 166 VETLVSSIFWTLAPWNNMLLLKHGRIEIVDQN 261 +ET +SSIFWTLAPWNNMLLLKHGRIEI+DQN Sbjct: 1 METPLSSIFWTLAPWNNMLLLKHGRIEILDQN 32 Score = 53.5 bits (127), Expect(3) = 5e-22 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 275 YERPKQEFVNSEQPVQIFTTKKY*ILFSFG 364 YE PKQEF+NSEQPVQIFTTKKY ILF G Sbjct: 38 YELPKQEFLNSEQPVQIFTTKKYWILFRIG 67 Score = 34.7 bits (78), Expect(3) = 5e-22 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +3 Query: 369 GPERRRKAGMPTGVY 413 GPERRRK GMPTGVY Sbjct: 67 GPERRRKGGMPTGVY 81 >sp|Q06GJ8.1|YCF15_PIPCE RecName: Full=Putative uncharacterized protein ycf15 gi|112253795|gb|ABI14516.1| hypothetical protein RF15 [Piper cenocladum] gi|112253812|gb|ABI14533.1| hypothetical protein RF15 [Piper cenocladum] Length = 88 Score = 65.9 bits (159), Expect(3) = 6e-22 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 166 VETLVSSIFWTLAPWNNMLLLKHGRIEIVDQN 261 +ETLVSSIFWTL PWNNMLLLKHGRIEI+DQN Sbjct: 1 METLVSSIFWTLTPWNNMLLLKHGRIEILDQN 32 Score = 48.9 bits (115), Expect(3) = 6e-22 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = +2 Query: 275 YERPKQEFVNSEQPVQIFTTKKY*ILFSFG 364 YE PKQEF+N EQP+QIFTT++Y ILF G Sbjct: 38 YELPKQEFLNGEQPIQIFTTERYWILFRIG 67 Score = 36.6 bits (83), Expect(3) = 6e-22 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = +3 Query: 369 GPERRRKAGMPTGVYC*IHPTR 434 GPERR KA MPT VY IHPTR Sbjct: 67 GPERRGKARMPTDVYYLIHPTR 88 >sp|Q33BV4.1|YCF15_NICTO RecName: Full=Putative uncharacterized protein ycf15 gi|80750972|dbj|BAE48048.1| Ycf15 protein [Nicotiana tomentosiformis] gi|80751005|dbj|BAE48081.1| Ycf15 protein [Nicotiana tomentosiformis] Length = 87 Score = 65.1 bits (157), Expect(3) = 6e-22 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 166 VETLVSSIFWTLAPWNNMLLLKHGRIEIVDQN 261 +ETLVSSIFWTLAPW NMLLLKHGRIEI+DQN Sbjct: 1 METLVSSIFWTLAPWKNMLLLKHGRIEILDQN 32 Score = 50.1 bits (118), Expect(3) = 6e-22 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +2 Query: 275 YERPKQEFVNSEQPVQIFTTKKY*ILFSFG 364 YE PKQEF++S+QPVQIFTTKKY ILF G Sbjct: 38 YELPKQEFLSSKQPVQIFTTKKYWILFRIG 67 Score = 36.2 bits (82), Expect(3) = 6e-22 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +3 Query: 369 GPERRRKAGMPTGVY 413 GPERRRKAGMPTGVY Sbjct: 67 GPERRRKAGMPTGVY 81 >ref|YP_008563133.1| hypothetical chloroplast RF15 (chloroplast) [Solanum lycopersicum] gi|544163676|ref|YP_008563150.1| hypothetical chloroplast RF15 (chloroplast) [Solanum lycopersicum] gi|544170716|ref|AP_004972.1| Ycf15 protein (chloroplast) [Solanum lycopersicum] gi|544170734|ref|AP_004990.1| ycf15 protein (chloroplast) [Solanum lycopersicum] gi|122201759|sp|Q2MI39.1|YCF15_SOLLC RecName: Full=Putative uncharacterized protein ycf15 gi|84372027|gb|ABC56344.1| hypothetical chloroplast RF15 (chloroplast) [Solanum lycopersicum] gi|84372046|gb|ABC56363.1| hypothetical chloroplast RF15 (chloroplast) [Solanum lycopersicum] gi|89241715|emb|CAJ32438.1| Ycf15 protein [Solanum lycopersicum] gi|89241733|emb|CAJ32456.1| ycf15 protein [Solanum lycopersicum] Length = 87 Score = 65.1 bits (157), Expect(3) = 8e-22 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 166 VETLVSSIFWTLAPWNNMLLLKHGRIEIVDQN 261 +ETLVSSIFWTLAPW NMLLLKHGRIEI+DQN Sbjct: 1 METLVSSIFWTLAPWKNMLLLKHGRIEILDQN 32 Score = 52.0 bits (123), Expect(3) = 8e-22 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 275 YERPKQEFVNSEQPVQIFTTKKY*ILFSFG 364 YE PKQEF+NS+QPVQIFTTKKY ILF G Sbjct: 38 YELPKQEFLNSKQPVQIFTTKKYWILFRIG 67 Score = 33.9 bits (76), Expect(3) = 8e-22 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +3 Query: 369 GPERRRKAGMPTGVY 413 GPERRRKAGMP GVY Sbjct: 67 GPERRRKAGMPIGVY 81 >gb|ADZ36326.1| hypothetical protein RF15 [Camellia obtusifolia] Length = 82 Score = 64.7 bits (156), Expect(3) = 2e-21 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +1 Query: 166 VETLVSSIFWTLAPWNNMLLLKHGRIEIVDQN 261 +ETL+SSIFWTLAPWNN+LLLKHGRIEI+DQN Sbjct: 1 METLLSSIFWTLAPWNNILLLKHGRIEILDQN 32 Score = 53.5 bits (127), Expect(3) = 2e-21 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 275 YERPKQEFVNSEQPVQIFTTKKY*ILFSFG 364 YE PKQEF+NSEQPVQIFTTKKY ILF G Sbjct: 38 YELPKQEFLNSEQPVQIFTTKKYWILFRIG 67 Score = 31.2 bits (69), Expect(3) = 2e-21 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +3 Query: 369 GPERRRKAGMPTGVY 413 GPERRRKA MPTGV+ Sbjct: 67 GPERRRKAEMPTGVH 81 >ref|YP_008081310.1| hypothetical chloroplast RF15 (chloroplast) [Catharanthus roseus] gi|511348398|ref|YP_008081327.1| hypothetical chloroplast RF15 (chloroplast) [Catharanthus roseus] gi|474452121|gb|AGI51189.1| hypothetical chloroplast RF15 (chloroplast) [Catharanthus roseus] gi|474452138|gb|AGI51206.1| hypothetical chloroplast RF15 (chloroplast) [Catharanthus roseus] Length = 67 Score = 68.6 bits (166), Expect(2) = 8e-21 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 166 VETLVSSIFWTLAPWNNMLLLKHGRIEIVDQN 261 +ETLVSSIFWTLAPWNNMLLLKHGRIEIVDQN Sbjct: 1 METLVSSIFWTLAPWNNMLLLKHGRIEIVDQN 32 Score = 58.9 bits (141), Expect(2) = 8e-21 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +2 Query: 275 YERPKQEFVNSEQPVQIFTTKKY*ILFSFG 364 YE PKQEFVNSEQPVQIFTTKKY ILFSFG Sbjct: 38 YELPKQEFVNSEQPVQIFTTKKYWILFSFG 67 >gb|ADZ36362.1| hypothetical protein RF15 [Symplocos paniculata] Length = 82 Score = 63.9 bits (154), Expect(3) = 1e-20 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 166 VETLVSSIFWTLAPWNNMLLLKHGRIEIVDQN 261 +E L+SSIFWTLAPWNNMLLLKHGRIEI+DQN Sbjct: 1 MEILLSSIFWTLAPWNNMLLLKHGRIEILDQN 32 Score = 53.5 bits (127), Expect(3) = 1e-20 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 275 YERPKQEFVNSEQPVQIFTTKKY*ILFSFG 364 YE PKQEF+NSEQPVQIFTTKKY ILF G Sbjct: 38 YELPKQEFLNSEQPVQIFTTKKYWILFRIG 67 Score = 29.6 bits (65), Expect(3) = 1e-20 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 369 GPERRRKAGMPTGVY 413 GPER RKA MPTGVY Sbjct: 67 GPERIRKAVMPTGVY 81 >ref|YP_004940553.1| ycf15 gene product (chloroplast) [Boea hygrometrica] gi|364284046|ref|YP_004940571.1| ycf15 gene product (chloroplast) [Boea hygrometrica] gi|340549451|gb|AEK53273.1| hypothetical chloroplast RF15 (chloroplast) [Boea hygrometrica] gi|340549469|gb|AEK53291.1| hypothetical chloroplast RF15 (chloroplast) [Boea hygrometrica] Length = 82 Score = 61.2 bits (147), Expect(3) = 1e-20 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 166 VETLVSSIFWTLAPWNNMLLLKHGRIEIVDQN 261 +ETL+SSIF TLAPWNNMLLLKHGRIEI+DQN Sbjct: 1 METLLSSIFLTLAPWNNMLLLKHGRIEILDQN 32 Score = 53.5 bits (127), Expect(3) = 1e-20 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 275 YERPKQEFVNSEQPVQIFTTKKY*ILFSFG 364 YE PKQEF+NSEQPVQIFTTKKY ILF G Sbjct: 38 YELPKQEFLNSEQPVQIFTTKKYWILFRIG 67 Score = 32.3 bits (72), Expect(3) = 1e-20 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +3 Query: 369 GPERRRKAGMPTGVY 413 GP+RRRK GMPTGVY Sbjct: 67 GPKRRRKDGMPTGVY 81 >ref|YP_008082625.1| hypothetical chloroplast RF15 (chloroplast) [Utricularia gibba] gi|519704568|ref|YP_008082644.1| hypothetical chloroplast RF15 (chloroplast) [Utricularia gibba] gi|498921898|gb|AGL61119.1| hypothetical chloroplast RF15 (chloroplast) [Utricularia gibba] gi|498921918|gb|AGL61139.1| hypothetical chloroplast RF15 (chloroplast) [Utricularia gibba] Length = 82 Score = 60.5 bits (145), Expect(3) = 6e-20 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 166 VETLVSSIFWTLAPWNNMLLLKHGRIEIVDQN 261 +ETL+SSIFWTLAPWNNMLL KH RIEI+DQN Sbjct: 1 METLLSSIFWTLAPWNNMLLPKHKRIEILDQN 32 Score = 51.6 bits (122), Expect(3) = 6e-20 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +2 Query: 275 YERPKQEFVNSEQPVQIFTTKKY*ILFSFG 364 YE PKQEF+NSEQPVQIFT KKY ILF G Sbjct: 38 YELPKQEFLNSEQPVQIFTAKKYWILFRIG 67 Score = 32.3 bits (72), Expect(3) = 6e-20 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 369 GPERRRKAGMPTGVY 413 GPERRRK G PTGVY Sbjct: 67 GPERRRKGGTPTGVY 81 >ref|YP_007890283.1| Ycf15 protein (chloroplast) [Cistanche deserticola] gi|501595134|ref|YP_007890289.1| Ycf15 protein (chloroplast) [Cistanche deserticola] gi|429536996|gb|AFZ99567.1| Ycf15 protein (chloroplast) [Cistanche deserticola] gi|429537002|gb|AFZ99573.1| Ycf15 protein (chloroplast) [Cistanche deserticola] Length = 82 Score = 59.7 bits (143), Expect(3) = 2e-19 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 166 VETLVSSIFWTLAPWNNMLLLKHGRIEIVDQN 261 +ETL+SSIFWTLAP NNMLLLKHG+IEI+DQN Sbjct: 1 METLLSSIFWTLAPSNNMLLLKHGKIEILDQN 32 Score = 52.4 bits (124), Expect(3) = 2e-19 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 275 YERPKQEFVNSEQPVQIFTTKKY*ILFSFG 364 YE PKQEF+NSEQPVQIFTTKKY +LF G Sbjct: 38 YELPKQEFLNSEQPVQIFTTKKYWMLFRIG 67 Score = 30.8 bits (68), Expect(3) = 2e-19 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 369 GPERRRKAGMPTGVY 413 G ERRRK GMPTGVY Sbjct: 67 GLERRRKGGMPTGVY 81 >sp|P68941.1|YCF15_OENPI RecName: Full=Putative uncharacterized protein ycf15; AltName: Full=ORF 80 gi|78112189|sp|P68942.1|YCF15_OENVI RecName: Full=Putative uncharacterized protein ycf15; AltName: Full=ORF 80 gi|13513074|emb|CAA45899.2| hypothetical protein [Oenothera odorata] gi|13516217|emb|CAA45897.2| hypothetical protein [Oenothera berteroana] Length = 80 Score = 55.1 bits (131), Expect(3) = 3e-16 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 166 VETLVSSIFWTLAPWNNMLLLKHGRIEIVDQN 261 +ET VSS+FWTLAP NNMLLLK GRIEI+DQN Sbjct: 1 METPVSSLFWTLAPRNNMLLLKDGRIEILDQN 32 Score = 43.1 bits (100), Expect(3) = 3e-16 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +2 Query: 275 YERPKQEFVNSEQPVQIFTTKKY*ILFSFG 364 YE PKQEF+NS + +QIFTTKKY I F G Sbjct: 38 YELPKQEFLNSVRTIQIFTTKKYCIPFRIG 67 Score = 33.5 bits (75), Expect(3) = 3e-16 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +3 Query: 369 GPERRRKAGMPTGV 410 GPERRRKAGMPTGV Sbjct: 67 GPERRRKAGMPTGV 80