BLASTX nr result
ID: Rauwolfia21_contig00004966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00004966 (758 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006441989.1| hypothetical protein CICLE_v10022861mg [Citr... 57 7e-06 >ref|XP_006441989.1| hypothetical protein CICLE_v10022861mg [Citrus clementina] gi|567899004|ref|XP_006441990.1| hypothetical protein CICLE_v10022861mg [Citrus clementina] gi|557544251|gb|ESR55229.1| hypothetical protein CICLE_v10022861mg [Citrus clementina] gi|557544252|gb|ESR55230.1| hypothetical protein CICLE_v10022861mg [Citrus clementina] Length = 126 Score = 57.0 bits (136), Expect = 7e-06 Identities = 30/70 (42%), Positives = 45/70 (64%) Frame = -2 Query: 502 MGVDQQKADLKLHSRGFMPLQDEYLSSIMDVRAAKRNATPSTEGRRIDYRRTFSQGHGKK 323 M D ++ +L S+G + LQD Y +SIMD R ++ ATP E R+++Y R++SQG +K Sbjct: 1 MNSDNSESRQRL-SKGIINLQDRYPTSIMD-RGVRKIATPPVEKRKVEYHRSYSQGASRK 58 Query: 322 ILSTSYFGAE 293 + S SYF E Sbjct: 59 LFSASYFTLE 68