BLASTX nr result
ID: Rauwolfia21_contig00004659
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00004659 (710 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004243331.1| PREDICTED: putative cell wall protein-like [... 62 2e-07 >ref|XP_004243331.1| PREDICTED: putative cell wall protein-like [Solanum lycopersicum] Length = 115 Score = 61.6 bits (148), Expect = 2e-07 Identities = 37/81 (45%), Positives = 49/81 (60%), Gaps = 4/81 (4%) Frame = -3 Query: 537 MAYRNFSILAFLLILNVLAAS----VLAGRHIAAKTSKTVDKKQPESFIGHDGTVLVPGL 370 MA SI + I+N++ S LAGR IA K K P++F +DGTVL+PG+ Sbjct: 1 MANSIHSIFSPFFIINIIFLSFSCYTLAGRDIAKINDKI---KHPDTFFPYDGTVLIPGI 57 Query: 369 GRYYLFPRPGTNFNPFTYNPI 307 GR + P+ GT+ NPFTYNPI Sbjct: 58 GRVVVPPK-GTHVNPFTYNPI 77