BLASTX nr result
ID: Rauwolfia21_contig00004551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00004551 (1510 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006480877.1| PREDICTED: probable protein S-acyltransferas... 40 8e-06 >ref|XP_006480877.1| PREDICTED: probable protein S-acyltransferase 16-like isoform X2 [Citrus sinensis] Length = 250 Score = 40.4 bits (93), Expect(2) = 8e-06 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = +2 Query: 197 HPIHFVVLRTEGGDLRYCQKCSLHKPP-LHITAVC 298 +P+H + + +GGDLRYCQKCS +KPP H VC Sbjct: 83 NPMHEI--KRKGGDLRYCQKCSHYKPPRAHHCRVC 115 Score = 37.7 bits (86), Expect(2) = 8e-06 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = +1 Query: 274 PTAHHCRVCNGCMLRMVCLV 333 P AHHCRVC C+LRMV LV Sbjct: 107 PRAHHCRVCKRCVLRMVLLV 126