BLASTX nr result
ID: Rauwolfia21_contig00003597
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00003597 (335 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519001.1| secretory carrier membrane protein, putative... 69 5e-10 ref|XP_002326571.1| predicted protein [Populus trichocarpa] gi|5... 69 8e-10 ref|XP_006368327.1| hypothetical protein POPTR_0001s01640g [Popu... 69 8e-10 gb|EXC26238.1| Secretory carrier-associated membrane protein 3 [... 68 1e-09 gb|AFK41920.1| unknown [Lotus japonicus] 68 1e-09 ref|XP_004512452.1| PREDICTED: secretory carrier-associated memb... 67 2e-09 gb|ESW30201.1| hypothetical protein PHAVU_002G133200g [Phaseolus... 67 2e-09 gb|EOY25269.1| SCAMP family protein isoform 2 [Theobroma cacao] 67 3e-09 gb|EOY25268.1| SCAMP family protein isoform 1 [Theobroma cacao] 67 3e-09 ref|XP_003612685.1| Secretory carrier-associated membrane protei... 66 4e-09 ref|NP_001241252.1| uncharacterized protein LOC100806586 [Glycin... 66 4e-09 ref|XP_002303454.1| secretory carrier membrane family protein [P... 66 5e-09 ref|NP_001241214.1| uncharacterized protein LOC100780723 [Glycin... 65 1e-08 gb|ACU18292.1| unknown [Glycine max] 65 1e-08 dbj|BAH03477.1| secretory carrier-associated membrane protein 2 ... 65 1e-08 ref|XP_006410715.1| hypothetical protein EUTSA_v10017084mg [Eutr... 64 2e-08 ref|XP_006415261.1| hypothetical protein EUTSA_v10008500mg [Eutr... 64 3e-08 ref|XP_006304101.1| hypothetical protein CARUB_v10010029mg [Caps... 64 3e-08 ref|NP_174485.1| secretory carrier-associated membrane protein 5... 64 3e-08 gb|AFK40014.1| unknown [Medicago truncatula] 64 3e-08 >ref|XP_002519001.1| secretory carrier membrane protein, putative [Ricinus communis] gi|223541988|gb|EEF43534.1| secretory carrier membrane protein, putative [Ricinus communis] Length = 272 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 334 IFYMVGFGLFCLESLLSLWVLQKVYMFFRGHK*FH 230 IFY+VGFGLFCLESLLSLWVLQKVYM+FRGHK H Sbjct: 238 IFYLVGFGLFCLESLLSLWVLQKVYMYFRGHKGDH 272 >ref|XP_002326571.1| predicted protein [Populus trichocarpa] gi|566146627|ref|XP_006368326.1| secretory carrier membrane family protein [Populus trichocarpa] gi|550346231|gb|ERP64895.1| secretory carrier membrane family protein [Populus trichocarpa] Length = 269 Score = 68.6 bits (166), Expect = 8e-10 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 334 IFYMVGFGLFCLESLLSLWVLQKVYMFFRGHK 239 IFY+VGFGLFCLESLLSLWVLQK+YM+FRGHK Sbjct: 238 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 269 >ref|XP_006368327.1| hypothetical protein POPTR_0001s01640g [Populus trichocarpa] gi|118482846|gb|ABK93338.1| unknown [Populus trichocarpa] gi|550346232|gb|ERP64896.1| hypothetical protein POPTR_0001s01640g [Populus trichocarpa] Length = 270 Score = 68.6 bits (166), Expect = 8e-10 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 334 IFYMVGFGLFCLESLLSLWVLQKVYMFFRGHK 239 IFY+VGFGLFCLESLLSLWVLQK+YM+FRGHK Sbjct: 239 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 270 >gb|EXC26238.1| Secretory carrier-associated membrane protein 3 [Morus notabilis] Length = 325 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 334 IFYMVGFGLFCLESLLSLWVLQKVYMFFRGHK 239 IFY+VGFGLFCLESLLSLWVLQKVY++FRGHK Sbjct: 294 IFYLVGFGLFCLESLLSLWVLQKVYLYFRGHK 325 >gb|AFK41920.1| unknown [Lotus japonicus] Length = 268 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -2 Query: 334 IFYMVGFGLFCLESLLSLWVLQKVYMFFRGHK 239 IFY+VGFGLFCLESLLSLWV+QK+Y+FFRGHK Sbjct: 237 IFYLVGFGLFCLESLLSLWVIQKIYLFFRGHK 268 >ref|XP_004512452.1| PREDICTED: secretory carrier-associated membrane protein 4-like [Cicer arietinum] Length = 267 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -2 Query: 334 IFYMVGFGLFCLESLLSLWVLQKVYMFFRGHK 239 IFY++GFGLFCLE+LLSLWV+QK+YMFFRGHK Sbjct: 236 IFYLIGFGLFCLEALLSLWVIQKIYMFFRGHK 267 >gb|ESW30201.1| hypothetical protein PHAVU_002G133200g [Phaseolus vulgaris] Length = 262 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -2 Query: 334 IFYMVGFGLFCLESLLSLWVLQKVYMFFRGHK 239 IFY++GFGLFCLE+LLSLWVLQK+YM+FRGHK Sbjct: 231 IFYLIGFGLFCLEALLSLWVLQKIYMYFRGHK 262 >gb|EOY25269.1| SCAMP family protein isoform 2 [Theobroma cacao] Length = 273 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 334 IFYMVGFGLFCLESLLSLWVLQKVYMFFRGHK 239 IFY VGFGLFCLESLLSLWVLQK+Y++FRGHK Sbjct: 242 IFYFVGFGLFCLESLLSLWVLQKIYLYFRGHK 273 >gb|EOY25268.1| SCAMP family protein isoform 1 [Theobroma cacao] Length = 265 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 334 IFYMVGFGLFCLESLLSLWVLQKVYMFFRGHK 239 IFY VGFGLFCLESLLSLWVLQK+Y++FRGHK Sbjct: 234 IFYFVGFGLFCLESLLSLWVLQKIYLYFRGHK 265 >ref|XP_003612685.1| Secretory carrier-associated membrane protein [Medicago truncatula] gi|355514020|gb|AES95643.1| Secretory carrier-associated membrane protein [Medicago truncatula] Length = 267 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -2 Query: 334 IFYMVGFGLFCLESLLSLWVLQKVYMFFRGHK 239 IFY++GFGLFCLE+LLSLWV+Q++YMFFRGHK Sbjct: 236 IFYLIGFGLFCLEALLSLWVIQRIYMFFRGHK 267 >ref|NP_001241252.1| uncharacterized protein LOC100806586 [Glycine max] gi|255638153|gb|ACU19390.1| unknown [Glycine max] Length = 269 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -2 Query: 334 IFYMVGFGLFCLESLLSLWVLQKVYMFFRGHK 239 IFY++GFG+FCLE+LLSLWVLQK+YM+FRGHK Sbjct: 238 IFYLIGFGMFCLEALLSLWVLQKIYMYFRGHK 269 >ref|XP_002303454.1| secretory carrier membrane family protein [Populus trichocarpa] gi|118486235|gb|ABK94959.1| unknown [Populus trichocarpa] gi|222840886|gb|EEE78433.1| secretory carrier membrane family protein [Populus trichocarpa] Length = 270 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -2 Query: 334 IFYMVGFGLFCLESLLSLWVLQKVYMFFRGHK 239 IFY+VGFGLFCLESLLSLWVLQK+YM+FRG+K Sbjct: 239 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGNK 270 >ref|NP_001241214.1| uncharacterized protein LOC100780723 [Glycine max] gi|255641378|gb|ACU20966.1| unknown [Glycine max] Length = 269 Score = 64.7 bits (156), Expect = 1e-08 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -2 Query: 334 IFYMVGFGLFCLESLLSLWVLQKVYMFFRGHK 239 IFY++GFG+FCLE+LLS WVLQK+YM+FRGHK Sbjct: 238 IFYLIGFGMFCLEALLSFWVLQKIYMYFRGHK 269 >gb|ACU18292.1| unknown [Glycine max] Length = 88 Score = 64.7 bits (156), Expect = 1e-08 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -2 Query: 334 IFYMVGFGLFCLESLLSLWVLQKVYMFFRGHK 239 IFY++GFG+FCLE+LLS WVLQK+YM+FRGHK Sbjct: 57 IFYLIGFGMFCLEALLSFWVLQKIYMYFRGHK 88 >dbj|BAH03477.1| secretory carrier-associated membrane protein 2 [Nicotiana tabacum] Length = 271 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 334 IFYMVGFGLFCLESLLSLWVLQKVYMFFRGHK 239 IFY++GF FCLE+LLSLWVLQKVYMFFRGHK Sbjct: 240 IFYLIGFAFFCLEALLSLWVLQKVYMFFRGHK 271 >ref|XP_006410715.1| hypothetical protein EUTSA_v10017084mg [Eutrema salsugineum] gi|312282067|dbj|BAJ33899.1| unnamed protein product [Thellungiella halophila] gi|557111884|gb|ESQ52168.1| hypothetical protein EUTSA_v10017084mg [Eutrema salsugineum] Length = 268 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 334 IFYMVGFGLFCLESLLSLWVLQKVYMFFRGHK 239 IFY VGFGLFCLESLLSLWVLQK+Y++FRG+K Sbjct: 237 IFYFVGFGLFCLESLLSLWVLQKIYLYFRGNK 268 >ref|XP_006415261.1| hypothetical protein EUTSA_v10008500mg [Eutrema salsugineum] gi|567145492|ref|XP_006415262.1| hypothetical protein EUTSA_v10008500mg [Eutrema salsugineum] gi|557093032|gb|ESQ33614.1| hypothetical protein EUTSA_v10008500mg [Eutrema salsugineum] gi|557093033|gb|ESQ33615.1| hypothetical protein EUTSA_v10008500mg [Eutrema salsugineum] Length = 264 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -2 Query: 334 IFYMVGFGLFCLESLLSLWVLQKVYMFFRGHK 239 IFY +GFGLFCLESLLSLWVLQK+Y++FRG+K Sbjct: 233 IFYFIGFGLFCLESLLSLWVLQKIYLYFRGNK 264 >ref|XP_006304101.1| hypothetical protein CARUB_v10010029mg [Capsella rubella] gi|482572812|gb|EOA36999.1| hypothetical protein CARUB_v10010029mg [Capsella rubella] Length = 265 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -2 Query: 334 IFYMVGFGLFCLESLLSLWVLQKVYMFFRGHK 239 IFY +GFGLFCLESLLSLWVLQK+Y++FRG+K Sbjct: 234 IFYFIGFGLFCLESLLSLWVLQKIYLYFRGNK 265 >ref|NP_174485.1| secretory carrier-associated membrane protein 5 [Arabidopsis thaliana] gi|75169200|sp|Q9C6X2.1|SCAM4_ARATH RecName: Full=Secretory carrier-associated membrane protein 4; Short=Secretory carrier membrane protein 4 gi|12321473|gb|AAG50798.1|AC074309_15 secretory carrier membrane protein, putative [Arabidopsis thaliana] gi|21592989|gb|AAM64938.1| secretory carrier membrane protein, putative [Arabidopsis thaliana] gi|107738363|gb|ABF83683.1| At1g32050 [Arabidopsis thaliana] gi|110741518|dbj|BAE98709.1| hypothetical protein [Arabidopsis thaliana] gi|332193308|gb|AEE31429.1| secretory carrier-associated membrane protein 4 [Arabidopsis thaliana] Length = 264 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -2 Query: 334 IFYMVGFGLFCLESLLSLWVLQKVYMFFRGHK 239 IFY +GFGLFCLESLLSLWVLQK+Y++FRG+K Sbjct: 233 IFYFIGFGLFCLESLLSLWVLQKIYLYFRGNK 264 >gb|AFK40014.1| unknown [Medicago truncatula] Length = 267 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 334 IFYMVGFGLFCLESLLSLWVLQKVYMFFRGHK 239 IFY++GFGLFCLE LSLWV+Q++YMFFRGHK Sbjct: 236 IFYLIGFGLFCLEVFLSLWVIQRIYMFFRGHK 267