BLASTX nr result
ID: Rauwolfia21_contig00001437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00001437 (366 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGH68506.1| histone H2B.1, partial [Ipomoea batatas] 79 8e-13 ref|XP_004240357.1| PREDICTED: histone H2B.6-like [Solanum lycop... 79 8e-13 gb|EXB52245.1| putative histone H2B.1 [Morus notabilis] 77 2e-12 ref|XP_006409905.1| hypothetical protein EUTSA_v10017370mg [Eutr... 77 2e-12 ref|XP_006384170.1| hypothetical protein POPTR_0004s09030g [Popu... 77 2e-12 ref|XP_006379009.1| hypothetical protein POPTR_0009s03310g [Popu... 77 2e-12 gb|EOY34119.1| Histone superfamily protein [Theobroma cacao] 77 2e-12 gb|EOY07601.1| Histone superfamily protein [Theobroma cacao] 77 2e-12 ref|XP_004302789.1| PREDICTED: histone H2B-like [Fragaria vesca ... 77 2e-12 gb|EMJ09025.1| hypothetical protein PRUPE_ppa023550mg [Prunus pe... 77 2e-12 ref|XP_004156571.1| PREDICTED: histone H2B.4-like [Cucumis sativus] 77 2e-12 ref|XP_004137790.1| PREDICTED: histone H2B.4-like [Cucumis sativus] 77 2e-12 ref|NP_180440.1| histone H2B [Arabidopsis thaliana] gi|75206064... 77 2e-12 ref|XP_002879182.1| hypothetical protein ARALYDRAFT_901825 [Arab... 77 2e-12 ref|XP_002305858.1| histone 2 [Populus trichocarpa] gi|224106525... 77 2e-12 ref|XP_002301712.1| histone 2 [Populus trichocarpa] gi|566171381... 77 2e-12 gb|EXC24908.1| Histone H2B.3 [Morus notabilis] 76 4e-12 sp|O22582.3|H2B_GOSHI RecName: Full=Histone H2B gi|2558962|gb|AA... 76 4e-12 ref|XP_003539691.2| PREDICTED: probable histone H2B.1-like isofo... 76 4e-12 ref|XP_003538007.2| PREDICTED: probable histone H2B.1-like isofo... 76 4e-12 >gb|AGH68506.1| histone H2B.1, partial [Ipomoea batatas] Length = 145 Score = 78.6 bits (192), Expect = 8e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 54 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 91 >ref|XP_004240357.1| PREDICTED: histone H2B.6-like [Solanum lycopersicum] gi|565390992|ref|XP_006361212.1| PREDICTED: histone H2B.11-like [Solanum tuberosum] Length = 147 Score = 78.6 bits (192), Expect = 8e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 56 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 93 >gb|EXB52245.1| putative histone H2B.1 [Morus notabilis] Length = 148 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 57 STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 94 >ref|XP_006409905.1| hypothetical protein EUTSA_v10017370mg [Eutrema salsugineum] gi|557111074|gb|ESQ51358.1| hypothetical protein EUTSA_v10017370mg [Eutrema salsugineum] Length = 152 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 61 STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 98 >ref|XP_006384170.1| hypothetical protein POPTR_0004s09030g [Populus trichocarpa] gi|550340640|gb|ERP61967.1| hypothetical protein POPTR_0004s09030g [Populus trichocarpa] Length = 147 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 56 STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 93 >ref|XP_006379009.1| hypothetical protein POPTR_0009s03310g [Populus trichocarpa] gi|550330942|gb|ERP56806.1| hypothetical protein POPTR_0009s03310g [Populus trichocarpa] Length = 148 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 57 STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 94 >gb|EOY34119.1| Histone superfamily protein [Theobroma cacao] Length = 148 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 57 STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 94 >gb|EOY07601.1| Histone superfamily protein [Theobroma cacao] Length = 139 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 48 STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 85 >ref|XP_004302789.1| PREDICTED: histone H2B-like [Fragaria vesca subsp. vesca] Length = 130 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 39 STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 76 >gb|EMJ09025.1| hypothetical protein PRUPE_ppa023550mg [Prunus persica] Length = 134 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 43 STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 80 >ref|XP_004156571.1| PREDICTED: histone H2B.4-like [Cucumis sativus] Length = 138 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 47 SNETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 84 >ref|XP_004137790.1| PREDICTED: histone H2B.4-like [Cucumis sativus] Length = 138 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 47 SNETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 84 >ref|NP_180440.1| histone H2B [Arabidopsis thaliana] gi|75206064|sp|Q9SI96.3|H2B3_ARATH RecName: Full=Histone H2B.3; Short=HTB3 gi|13272409|gb|AAK17143.1|AF325075_1 putative histone H2B [Arabidopsis thaliana] gi|4580384|gb|AAD24363.1| putative histone H2B [Arabidopsis thaliana] gi|16209685|gb|AAL14400.1| At2g28720/T11P11.3 [Arabidopsis thaliana] gi|21553526|gb|AAM62619.1| putative histone H2B [Arabidopsis thaliana] gi|21700841|gb|AAM70544.1| At2g28720/T11P11.3 [Arabidopsis thaliana] gi|330253069|gb|AEC08163.1| histone H2B [Arabidopsis thaliana] Length = 151 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 60 STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 97 >ref|XP_002879182.1| hypothetical protein ARALYDRAFT_901825 [Arabidopsis lyrata subsp. lyrata] gi|297325021|gb|EFH55441.1| hypothetical protein ARALYDRAFT_901825 [Arabidopsis lyrata subsp. lyrata] Length = 154 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 63 STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 100 >ref|XP_002305858.1| histone 2 [Populus trichocarpa] gi|224106525|ref|XP_002314196.1| histone 2 [Populus trichocarpa] Length = 93 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 2 STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 39 >ref|XP_002301712.1| histone 2 [Populus trichocarpa] gi|566171381|ref|XP_006383343.1| histone H2B family protein [Populus trichocarpa] gi|118489629|gb|ABK96616.1| unknown [Populus trichocarpa x Populus deltoides] gi|550338952|gb|ERP61140.1| histone H2B family protein [Populus trichocarpa] Length = 148 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 57 STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 94 >gb|EXC24908.1| Histone H2B.3 [Morus notabilis] Length = 146 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 55 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 92 >sp|O22582.3|H2B_GOSHI RecName: Full=Histone H2B gi|2558962|gb|AAB97163.1| histone H2B1 [Gossypium hirsutum] Length = 147 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 56 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 93 >ref|XP_003539691.2| PREDICTED: probable histone H2B.1-like isoform 1 [Glycine max] Length = 292 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 58 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 95 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 201 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 238 >ref|XP_003538007.2| PREDICTED: probable histone H2B.1-like isoform 1 [Glycine max] Length = 290 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 57 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 94 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 251 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 364 S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF Sbjct: 199 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIF 236