BLASTX nr result
ID: Rauwolfia21_contig00001278
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00001278 (320 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC17678.1| Serine carboxypeptidase-like 7 [Morus notabilis] 56 6e-06 >gb|EXC17678.1| Serine carboxypeptidase-like 7 [Morus notabilis] Length = 759 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 98 LQGYLLGNPGSSPADGNYQVQFAHGMGLISDE 3 LQGY+LGNP +SP+D NY++ FAHGM LISDE Sbjct: 209 LQGYILGNPATSPSDDNYKIPFAHGMALISDE 240