BLASTX nr result
ID: Phellodendron21_contig00033587
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033587 (346 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007414971.1 hypothetical protein MELLADRAFT_75553 [Melampsora... 77 9e-15 XP_001935711.1 low affinity copper transporter [Pyrenophora trit... 61 5e-09 XP_018390880.1 Ctr copper transporter-like protein [Alternaria a... 60 1e-08 XP_014560245.1 hypothetical protein COCVIDRAFT_89976 [Bipolaris ... 59 2e-08 XP_007682999.1 hypothetical protein COCMIDRAFT_22081 [Bipolaris ... 59 2e-08 XP_007706741.1 hypothetical protein COCCADRAFT_81807 [Bipolaris ... 59 2e-08 XP_014084769.1 hypothetical protein COCC4DRAFT_157035 [Bipolaris... 59 2e-08 XP_007694647.1 hypothetical protein COCSADRAFT_208115 [Bipolaris... 59 2e-08 OAV96079.1 hypothetical protein PTTG_02104 [Puccinia triticina 1... 59 2e-08 OAL51137.1 Ctr copper transporter-like protein [Pyrenochaeta sp.... 58 5e-08 XP_003890320.1 hypothetical protein PGTG_21057 [Puccinia gramini... 58 6e-08 XP_007408746.1 hypothetical protein MELLADRAFT_35219 [Melampsora... 57 1e-07 KNG50131.1 ctr copper transporter [Stemphylium lycopersici] 57 1e-07 XP_018035352.1 Ctr copper transporter-like protein [Paraphaeosph... 57 1e-07 OCK84745.1 putative Ctr copper transporter [Lepidopterella palus... 57 2e-07 KNE92839.1 hypothetical protein PSTG_13751 [Puccinia striiformis... 58 2e-07 OCK90035.1 low affinity copper transporter [Cenococcum geophilum... 56 2e-07 XP_007781730.1 hypothetical protein W97_05510 [Coniosporium apol... 56 2e-07 XP_007406355.1 hypothetical protein MELLADRAFT_115525 [Melampsor... 56 3e-07 XP_016219415.1 hypothetical protein PV09_00419 [Verruconis gallo... 55 4e-07 >XP_007414971.1 hypothetical protein MELLADRAFT_75553 [Melampsora larici-populina 98AG31] EGG01871.1 hypothetical protein MELLADRAFT_75553 [Melampsora larici-populina 98AG31] Length = 226 Score = 76.6 bits (187), Expect = 9e-15 Identities = 34/42 (80%), Positives = 41/42 (97%) Frame = +3 Query: 6 LVTLRAGLGYLLMLAVMTYNVYYFIAILLGTFMGEVIFGETD 131 LVT++AGLGYLLMLAVMTYN+YYF+AIL+GTF+GE IFG+TD Sbjct: 178 LVTIQAGLGYLLMLAVMTYNIYYFMAILMGTFIGEAIFGQTD 219 >XP_001935711.1 low affinity copper transporter [Pyrenophora tritici-repentis Pt-1C-BFP] EDU48298.1 low affinity copper transporter [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 194 Score = 60.8 bits (146), Expect = 5e-09 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = +3 Query: 3 LLVTLRAGLGYLLMLAVMTYNVYYFIAILLGTFMGEVIFG 122 +LV + AG+GYLLMLAVMTYN+ YF+++L GTF+GEV FG Sbjct: 147 VLVMIAAGVGYLLMLAVMTYNIGYFMSVLAGTFIGEVAFG 186 >XP_018390880.1 Ctr copper transporter-like protein [Alternaria alternata] OAG25459.1 Ctr copper transporter-like protein [Alternaria alternata] Length = 194 Score = 59.7 bits (143), Expect = 1e-08 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = +3 Query: 3 LLVTLRAGLGYLLMLAVMTYNVYYFIAILLGTFMGEVIFG 122 L++T+ AG+GYLLMLAVMTYNV YF+++L G F+GE+ FG Sbjct: 147 LIMTVAAGVGYLLMLAVMTYNVGYFLSVLAGAFVGELAFG 186 >XP_014560245.1 hypothetical protein COCVIDRAFT_89976 [Bipolaris victoriae FI3] EUN30667.1 hypothetical protein COCVIDRAFT_89976 [Bipolaris victoriae FI3] Length = 191 Score = 59.3 bits (142), Expect = 2e-08 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = +3 Query: 6 LVTLRAGLGYLLMLAVMTYNVYYFIAILLGTFMGEVIFG 122 L+T+ AG+GYLLMLAVMT+NV YF+++L GTF+GE+ FG Sbjct: 145 LMTVAAGVGYLLMLAVMTFNVGYFLSVLAGTFVGELAFG 183 >XP_007682999.1 hypothetical protein COCMIDRAFT_22081 [Bipolaris oryzae ATCC 44560] EUC50473.1 hypothetical protein COCMIDRAFT_22081 [Bipolaris oryzae ATCC 44560] Length = 191 Score = 59.3 bits (142), Expect = 2e-08 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = +3 Query: 6 LVTLRAGLGYLLMLAVMTYNVYYFIAILLGTFMGEVIFG 122 L+T+ AG+GYLLMLAVMT+NV YF+++L GTF+GE+ FG Sbjct: 145 LMTVAAGVGYLLMLAVMTFNVGYFLSVLAGTFVGELAFG 183 >XP_007706741.1 hypothetical protein COCCADRAFT_81807 [Bipolaris zeicola 26-R-13] EUC38898.1 hypothetical protein COCCADRAFT_81807 [Bipolaris zeicola 26-R-13] Length = 191 Score = 59.3 bits (142), Expect = 2e-08 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = +3 Query: 6 LVTLRAGLGYLLMLAVMTYNVYYFIAILLGTFMGEVIFG 122 L+T+ AG+GYLLMLAVMT+NV YF+++L GTF+GE+ FG Sbjct: 145 LMTVAAGVGYLLMLAVMTFNVGYFLSVLAGTFVGELAFG 183 >XP_014084769.1 hypothetical protein COCC4DRAFT_157035 [Bipolaris maydis ATCC 48331] EMD96002.1 hypothetical protein COCHEDRAFT_1019489 [Bipolaris maydis C5] ENI10860.1 hypothetical protein COCC4DRAFT_157035 [Bipolaris maydis ATCC 48331] Length = 191 Score = 59.3 bits (142), Expect = 2e-08 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = +3 Query: 6 LVTLRAGLGYLLMLAVMTYNVYYFIAILLGTFMGEVIFG 122 L+T+ AG+GYLLMLAVMT+NV YF+++L GTF+GE+ FG Sbjct: 145 LMTVAAGVGYLLMLAVMTFNVGYFLSVLAGTFVGELAFG 183 >XP_007694647.1 hypothetical protein COCSADRAFT_208115 [Bipolaris sorokiniana ND90Pr] EMD69263.1 hypothetical protein COCSADRAFT_208115 [Bipolaris sorokiniana ND90Pr] Length = 191 Score = 59.3 bits (142), Expect = 2e-08 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = +3 Query: 6 LVTLRAGLGYLLMLAVMTYNVYYFIAILLGTFMGEVIFG 122 L+T+ AG+GYLLMLAVMT+NV YF+++L GTF+GE+ FG Sbjct: 145 LMTVAAGVGYLLMLAVMTFNVGYFLSVLAGTFVGELAFG 183 >OAV96079.1 hypothetical protein PTTG_02104 [Puccinia triticina 1-1 BBBD Race 1] Length = 193 Score = 59.3 bits (142), Expect = 2e-08 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +3 Query: 3 LLVTLRAGLGYLLMLAVMTYNVYYFIAILLGTFMGEVIFG 122 +L L GL Y LMLAVMTYNVY+F+AI+LG F+GEV FG Sbjct: 144 ILAALHVGLEYFLMLAVMTYNVYFFVAIVLGHFVGEVAFG 183 >OAL51137.1 Ctr copper transporter-like protein [Pyrenochaeta sp. DS3sAY3a] Length = 195 Score = 58.2 bits (139), Expect = 5e-08 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = +3 Query: 3 LLVTLRAGLGYLLMLAVMTYNVYYFIAILLGTFMGEVIFG 122 LL+T+ A +GYLLMLAVMTYNV YF+++L G F+GE+ FG Sbjct: 147 LLMTVAAAVGYLLMLAVMTYNVGYFLSVLAGAFIGELAFG 186 >XP_003890320.1 hypothetical protein PGTG_21057 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EHS64799.1 hypothetical protein PGTG_21057 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 183 Score = 57.8 bits (138), Expect = 6e-08 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +3 Query: 3 LLVTLRAGLGYLLMLAVMTYNVYYFIAILLGTFMGEVIFG 122 +L L GL Y LMLAVMT+NVY+F+AI+LG F+GEV FG Sbjct: 134 ILAALHVGLEYFLMLAVMTFNVYFFVAIVLGHFVGEVAFG 173 >XP_007408746.1 hypothetical protein MELLADRAFT_35219 [Melampsora larici-populina 98AG31] EGG07981.1 hypothetical protein MELLADRAFT_35219 [Melampsora larici-populina 98AG31] Length = 149 Score = 56.6 bits (135), Expect = 1e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +3 Query: 3 LLVTLRAGLGYLLMLAVMTYNVYYFIAILLGTFMGEVIFG 122 +L + +GL Y LMLAVMT+NVY+FIAI+LG F GEV FG Sbjct: 102 ILAAVHSGLDYFLMLAVMTFNVYFFIAIILGLFAGEVGFG 141 >KNG50131.1 ctr copper transporter [Stemphylium lycopersici] Length = 194 Score = 57.4 bits (137), Expect = 1e-07 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = +3 Query: 6 LVTLRAGLGYLLMLAVMTYNVYYFIAILLGTFMGEVIFG 122 L+ AG+GYLLMLAVMTYNV YF+++L GTF+GE+ FG Sbjct: 148 LMMTAAGVGYLLMLAVMTYNVGYFMSVLAGTFVGELAFG 186 >XP_018035352.1 Ctr copper transporter-like protein [Paraphaeosphaeria sporulosa] OAG04987.1 Ctr copper transporter-like protein [Paraphaeosphaeria sporulosa] Length = 195 Score = 57.0 bits (136), Expect = 1e-07 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +3 Query: 6 LVTLRAGLGYLLMLAVMTYNVYYFIAILLGTFMGEVIFG 122 ++TL AG+GYLLMLAVMTYNV YF+++L G F+GE+ G Sbjct: 148 IMTLAAGVGYLLMLAVMTYNVGYFLSVLAGAFIGELALG 186 >OCK84745.1 putative Ctr copper transporter [Lepidopterella palustris CBS 459.81] Length = 176 Score = 56.6 bits (135), Expect = 2e-07 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +3 Query: 6 LVTLRAGLGYLLMLAVMTYNVYYFIAILLGTFMGEVIFG 122 LVT+ G+GYLLMLAVMT+NV YF+++L G F+GE+ FG Sbjct: 128 LVTIMGGVGYLLMLAVMTFNVGYFMSVLAGIFIGELAFG 166 >KNE92839.1 hypothetical protein PSTG_13751 [Puccinia striiformis f. sp. tritici PST-78] Length = 340 Score = 57.8 bits (138), Expect = 2e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +3 Query: 3 LLVTLRAGLGYLLMLAVMTYNVYYFIAILLGTFMGEVIFG 122 +L L GL Y LMLA+MTYNVY+F+AI+LG F+GE+ FG Sbjct: 291 ILAALHVGLEYFLMLAIMTYNVYFFVAIVLGHFVGEMAFG 330 >OCK90035.1 low affinity copper transporter [Cenococcum geophilum 1.58] Length = 175 Score = 56.2 bits (134), Expect = 2e-07 Identities = 24/40 (60%), Positives = 34/40 (85%) Frame = +3 Query: 3 LLVTLRAGLGYLLMLAVMTYNVYYFIAILLGTFMGEVIFG 122 LLV + G+GYLLMLAVMT+NV YF++++ G F+GE++FG Sbjct: 128 LLVMIMGGVGYLLMLAVMTFNVGYFMSVVAGIFIGELVFG 167 >XP_007781730.1 hypothetical protein W97_05510 [Coniosporium apollinis CBS 100218] EON66413.1 hypothetical protein W97_05510 [Coniosporium apollinis CBS 100218] Length = 184 Score = 56.2 bits (134), Expect = 2e-07 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +3 Query: 3 LLVTLRAGLGYLLMLAVMTYNVYYFIAILLGTFMGEVIFG 122 LLVT+ G+GYLLMLAVMT NV YF+++L GTF+GE+ G Sbjct: 135 LLVTVMVGVGYLLMLAVMTLNVGYFLSVLAGTFVGELAVG 174 >XP_007406355.1 hypothetical protein MELLADRAFT_115525 [Melampsora larici-populina 98AG31] EGG10054.1 hypothetical protein MELLADRAFT_115525 [Melampsora larici-populina 98AG31] Length = 170 Score = 55.8 bits (133), Expect = 3e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +3 Query: 3 LLVTLRAGLGYLLMLAVMTYNVYYFIAILLGTFMGEVIFG 122 +L + G+G LMLAVMTYN Y+FIAI+LG F GEV FG Sbjct: 122 ILAAIHYGIGSFLMLAVMTYNAYFFIAIILGVFAGEVAFG 161 >XP_016219415.1 hypothetical protein PV09_00419 [Verruconis gallopava] KIW09546.1 hypothetical protein PV09_00419 [Verruconis gallopava] Length = 173 Score = 55.5 bits (132), Expect = 4e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +3 Query: 6 LVTLRAGLGYLLMLAVMTYNVYYFIAILLGTFMGEVIFG 122 LVT+ G+GYLLMLAVMT NV YF++IL GTF+GE+ G Sbjct: 125 LVTVIGGIGYLLMLAVMTLNVGYFLSILAGTFVGEIAVG 163