BLASTX nr result
ID: Phellodendron21_contig00030281
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00030281 (284 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO56771.1 hypothetical protein CISIN_1g042150mg, partial [Citru... 57 2e-07 XP_006422018.1 hypothetical protein CICLE_v10007188mg [Citrus cl... 57 2e-07 >KDO56771.1 hypothetical protein CISIN_1g042150mg, partial [Citrus sinensis] Length = 803 Score = 57.0 bits (136), Expect = 2e-07 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 2 APSSYVREEEEDDGNASSDLRTSRIFSQLMTNEGR 106 APSS+VRE+E D GNASSDLRTS++FSQLMTNEGR Sbjct: 770 APSSHVREKEVD-GNASSDLRTSQVFSQLMTNEGR 803 >XP_006422018.1 hypothetical protein CICLE_v10007188mg [Citrus clementina] XP_006490646.1 PREDICTED: probable receptor-like protein kinase At5g24010 [Citrus sinensis] ESR35258.1 hypothetical protein CICLE_v10007188mg [Citrus clementina] Length = 839 Score = 57.0 bits (136), Expect = 2e-07 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 2 APSSYVREEEEDDGNASSDLRTSRIFSQLMTNEGR 106 APSS+VRE+E D GNASSDLRTS++FSQLMTNEGR Sbjct: 806 APSSHVREKEVD-GNASSDLRTSQVFSQLMTNEGR 839