BLASTX nr result
ID: Perilla23_contig00030377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00030377 (504 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081936.1| PREDICTED: pentatricopeptide repeat-containi... 218 2e-54 ref|XP_012855980.1| PREDICTED: pentatricopeptide repeat-containi... 206 5e-51 gb|EYU21955.1| hypothetical protein MIMGU_mgv1a001349mg [Erythra... 206 5e-51 emb|CDP04793.1| unnamed protein product [Coffea canephora] 145 1e-32 ref|XP_010648635.1| PREDICTED: pentatricopeptide repeat-containi... 139 1e-30 emb|CBI21003.3| unnamed protein product [Vitis vinifera] 139 1e-30 ref|XP_003631789.1| PREDICTED: pentatricopeptide repeat-containi... 139 1e-30 ref|XP_004514126.1| PREDICTED: pentatricopeptide repeat-containi... 131 2e-28 gb|KOM58419.1| hypothetical protein LR48_Vigan11g145300 [Vigna a... 126 7e-27 ref|XP_010094870.1| hypothetical protein L484_016452 [Morus nota... 124 2e-26 ref|XP_008370080.1| PREDICTED: pentatricopeptide repeat-containi... 124 2e-26 ref|XP_007013815.1| Pentatricopeptide repeat superfamily protein... 124 4e-26 ref|XP_014515022.1| PREDICTED: pentatricopeptide repeat-containi... 123 5e-26 ref|XP_009784742.1| PREDICTED: pentatricopeptide repeat-containi... 123 5e-26 ref|XP_006450492.1| hypothetical protein CICLE_v10010816mg [Citr... 123 5e-26 ref|XP_009377786.1| PREDICTED: pentatricopeptide repeat-containi... 121 2e-25 ref|XP_012456260.1| PREDICTED: pentatricopeptide repeat-containi... 120 3e-25 gb|KDO61668.1| hypothetical protein CISIN_1g043440mg, partial [C... 120 3e-25 ref|XP_009604239.1| PREDICTED: pentatricopeptide repeat-containi... 119 1e-24 ref|XP_009615415.1| PREDICTED: pentatricopeptide repeat-containi... 118 2e-24 >ref|XP_011081936.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] gi|747070249|ref|XP_011081937.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] gi|747070251|ref|XP_011081938.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] gi|747070253|ref|XP_011081939.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] Length = 859 Score = 218 bits (554), Expect = 2e-54 Identities = 112/168 (66%), Positives = 126/168 (75%) Frame = -1 Query: 504 QNTSKIPTFPKPVTENAAFSHKDVADVLFSYKNDPQTALEYFKSVGKQRGFVREIGDSFF 325 QN+ KI TF P +N S V D L S+ NDP ALEYF+SV KQ GFVREIGDSFF Sbjct: 61 QNSIKIQTFQNPFADNTRLSQIYVVDTLLSHINDPLAALEYFRSVEKQPGFVREIGDSFF 120 Query: 324 VLLHILVTFPKCHDLARSLINDYVSWDSAPSCVVVVDHLIGCSERFGFRLKPRLFDYFLN 145 VLLHILV+ H AR+L+N+Y+S DSAPS VV+VD LI CSERFGF LKPR+FDY LN Sbjct: 121 VLLHILVSSRDHHGAARNLLNNYLSGDSAPSGVVLVDRLINCSERFGFGLKPRVFDYLLN 180 Query: 144 GYVRARRYKDAEDCFYSLVWRGTVPSEIILNNFLKSLIRANVFDNARG 1 GYV+ARRYKDAEDCFY LV RG P ILNNFL SLIR+N+ D ARG Sbjct: 181 GYVKARRYKDAEDCFYLLVSRGITPHVRILNNFLSSLIRSNMIDEARG 228 >ref|XP_012855980.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Erythranthe guttatus] Length = 849 Score = 206 bits (524), Expect = 5e-51 Identities = 104/168 (61%), Positives = 126/168 (75%) Frame = -1 Query: 504 QNTSKIPTFPKPVTENAAFSHKDVADVLFSYKNDPQTALEYFKSVGKQRGFVREIGDSFF 325 QN KI TF KP++EN S +V + L S NDP++AL+YF+ KQRGFVREIGDSF Sbjct: 51 QNPIKIQTFQKPISENPRLSQANVVETLLSNFNDPRSALDYFRWAEKQRGFVREIGDSFL 110 Query: 324 VLLHILVTFPKCHDLARSLINDYVSWDSAPSCVVVVDHLIGCSERFGFRLKPRLFDYFLN 145 VLLHILV+ H AR+L+N+Y+S DSAPS V+V LI CS++FGFR PR+FDY LN Sbjct: 111 VLLHILVSSHYHHGSARNLLNNYLSSDSAPSGGVLVQRLIDCSDKFGFRRSPRIFDYALN 170 Query: 144 GYVRARRYKDAEDCFYSLVWRGTVPSEIILNNFLKSLIRANVFDNARG 1 GYVRA+RYKDAEDCFY+LV RG +P ILNNFL SLIR ++ D ARG Sbjct: 171 GYVRAQRYKDAEDCFYALVSRGVIPCVRILNNFLHSLIRTSMIDEARG 218 >gb|EYU21955.1| hypothetical protein MIMGU_mgv1a001349mg [Erythranthe guttata] Length = 836 Score = 206 bits (524), Expect = 5e-51 Identities = 104/168 (61%), Positives = 126/168 (75%) Frame = -1 Query: 504 QNTSKIPTFPKPVTENAAFSHKDVADVLFSYKNDPQTALEYFKSVGKQRGFVREIGDSFF 325 QN KI TF KP++EN S +V + L S NDP++AL+YF+ KQRGFVREIGDSF Sbjct: 51 QNPIKIQTFQKPISENPRLSQANVVETLLSNFNDPRSALDYFRWAEKQRGFVREIGDSFL 110 Query: 324 VLLHILVTFPKCHDLARSLINDYVSWDSAPSCVVVVDHLIGCSERFGFRLKPRLFDYFLN 145 VLLHILV+ H AR+L+N+Y+S DSAPS V+V LI CS++FGFR PR+FDY LN Sbjct: 111 VLLHILVSSHYHHGSARNLLNNYLSSDSAPSGGVLVQRLIDCSDKFGFRRSPRIFDYALN 170 Query: 144 GYVRARRYKDAEDCFYSLVWRGTVPSEIILNNFLKSLIRANVFDNARG 1 GYVRA+RYKDAEDCFY+LV RG +P ILNNFL SLIR ++ D ARG Sbjct: 171 GYVRAQRYKDAEDCFYALVSRGVIPCVRILNNFLHSLIRTSMIDEARG 218 >emb|CDP04793.1| unnamed protein product [Coffea canephora] Length = 856 Score = 145 bits (366), Expect = 1e-32 Identities = 71/157 (45%), Positives = 102/157 (64%) Frame = -1 Query: 474 KPVTENAAFSHKDVADVLFSYKNDPQTALEYFKSVGKQRGFVREIGDSFFVLLHILVTFP 295 KP++EN S V + L S++NDP A +YF+ QRGF+R + D + VLLHILV+ P Sbjct: 68 KPISENPGLSQTHVVESLLSHRNDPAAAFKYFQWAEGQRGFLRGVSDPYCVLLHILVSSP 127 Query: 294 KCHDLARSLINDYVSWDSAPSCVVVVDHLIGCSERFGFRLKPRLFDYFLNGYVRARRYKD 115 + L R L+N YVS DS+PS +++ DHLI CSERF F L +F+Y LN YVRA R +D Sbjct: 128 NEYSLTRRLLNSYVSSDSSPSGILLFDHLISCSERFDFPLNSEVFNYLLNSYVRACRNRD 187 Query: 114 AEDCFYSLVWRGTVPSEIILNNFLKSLIRANVFDNAR 4 A DCF+++V +P+ +++ L +L+R + AR Sbjct: 188 AIDCFHAMVSCNIMPNVTVVSITLSALVRRKLISEAR 224 >ref|XP_010648635.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X3 [Vitis vinifera] Length = 1204 Score = 139 bits (349), Expect = 1e-30 Identities = 71/153 (46%), Positives = 96/153 (62%) Frame = -1 Query: 462 ENAAFSHKDVADVLFSYKNDPQTALEYFKSVGKQRGFVREIGDSFFVLLHILVTFPKCHD 283 E S V D L + NDPQ+AL YFK QRGF+R + D++ VLLHIL+ P+ H Sbjct: 421 ETTPLSQNHVIDALLCHVNDPQSALRYFKRAETQRGFIRGV-DAYCVLLHILMRSPETHG 479 Query: 282 LARSLINDYVSWDSAPSCVVVVDHLIGCSERFGFRLKPRLFDYFLNGYVRARRYKDAEDC 103 AR L+N YVS DS PS VV VDHLI C++RF F L R+F+Y LN Y+RA R ++A DC Sbjct: 480 HARKLLNRYVSGDSDPSPVVFVDHLINCAKRFDFELDHRVFNYLLNAYIRANRIENAIDC 539 Query: 102 FYSLVWRGTVPSEIILNNFLKSLIRANVFDNAR 4 F +++ + +P +N L +L+R N+ R Sbjct: 540 FNAMICQDVIPWVPYMNILLTALVRRNMIGELR 572 >emb|CBI21003.3| unnamed protein product [Vitis vinifera] Length = 837 Score = 139 bits (349), Expect = 1e-30 Identities = 71/153 (46%), Positives = 96/153 (62%) Frame = -1 Query: 462 ENAAFSHKDVADVLFSYKNDPQTALEYFKSVGKQRGFVREIGDSFFVLLHILVTFPKCHD 283 E S V D L + NDPQ+AL YFK QRGF+R + D++ VLLHIL+ P+ H Sbjct: 54 ETTPLSQNHVIDALLCHVNDPQSALRYFKRAETQRGFIRGV-DAYCVLLHILMRSPETHG 112 Query: 282 LARSLINDYVSWDSAPSCVVVVDHLIGCSERFGFRLKPRLFDYFLNGYVRARRYKDAEDC 103 AR L+N YVS DS PS VV VDHLI C++RF F L R+F+Y LN Y+RA R ++A DC Sbjct: 113 HARKLLNRYVSGDSDPSPVVFVDHLINCAKRFDFELDHRVFNYLLNAYIRANRIENAIDC 172 Query: 102 FYSLVWRGTVPSEIILNNFLKSLIRANVFDNAR 4 F +++ + +P +N L +L+R N+ R Sbjct: 173 FNAMICQDVIPWVPYMNILLTALVRRNMIGELR 205 >ref|XP_003631789.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385776|ref|XP_010648630.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385778|ref|XP_010648631.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385781|ref|XP_010648632.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385783|ref|XP_010648633.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385785|ref|XP_010648634.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] Length = 877 Score = 139 bits (349), Expect = 1e-30 Identities = 71/153 (46%), Positives = 96/153 (62%) Frame = -1 Query: 462 ENAAFSHKDVADVLFSYKNDPQTALEYFKSVGKQRGFVREIGDSFFVLLHILVTFPKCHD 283 E S V D L + NDPQ+AL YFK QRGF+R + D++ VLLHIL+ P+ H Sbjct: 94 ETTPLSQNHVIDALLCHVNDPQSALRYFKRAETQRGFIRGV-DAYCVLLHILMRSPETHG 152 Query: 282 LARSLINDYVSWDSAPSCVVVVDHLIGCSERFGFRLKPRLFDYFLNGYVRARRYKDAEDC 103 AR L+N YVS DS PS VV VDHLI C++RF F L R+F+Y LN Y+RA R ++A DC Sbjct: 153 HARKLLNRYVSGDSDPSPVVFVDHLINCAKRFDFELDHRVFNYLLNAYIRANRIENAIDC 212 Query: 102 FYSLVWRGTVPSEIILNNFLKSLIRANVFDNAR 4 F +++ + +P +N L +L+R N+ R Sbjct: 213 FNAMICQDVIPWVPYMNILLTALVRRNMIGELR 245 >ref|XP_004514126.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Cicer arietinum] Length = 850 Score = 131 bits (329), Expect = 2e-28 Identities = 66/161 (40%), Positives = 105/161 (65%) Frame = -1 Query: 486 PTFPKPVTENAAFSHKDVADVLFSYKNDPQTALEYFKSVGKQRGFVREIGDSFFVLLHIL 307 P FP+ + + S + D L ++K++P++AL++FK V ++RGFV+ + D F +LL IL Sbjct: 63 PNFPEKIISTSN-SQNQILDTLLTHKSNPKSALKFFKGVERKRGFVKTV-DVFSLLLQIL 120 Query: 306 VTFPKCHDLARSLINDYVSWDSAPSCVVVVDHLIGCSERFGFRLKPRLFDYFLNGYVRAR 127 + P+ H R+L+N+YV DS+PS V+V+HL+ CS R+GF R+F+Y LN YVRA Sbjct: 121 SSTPQTHSSLRNLLNNYVFGDSSPSPKVLVEHLLECSGRYGFESDSRVFNYLLNSYVRAN 180 Query: 126 RYKDAEDCFYSLVWRGTVPSEIILNNFLKSLIRANVFDNAR 4 + DA +CF +L+ +P I+N L +++R N+ NAR Sbjct: 181 KIVDAVECFRTLLEHDVIPWVPIMNILLTAMVRRNMICNAR 221 >gb|KOM58419.1| hypothetical protein LR48_Vigan11g145300 [Vigna angularis] Length = 837 Score = 126 bits (316), Expect = 7e-27 Identities = 65/147 (44%), Positives = 97/147 (65%), Gaps = 1/147 (0%) Frame = -1 Query: 447 SHKDVADVLFSYKNDPQTALEYFKSVGKQRGFVREIGDSFFVLLHILVTFPKCHDLARSL 268 S +V D L +K DP++AL +FK V +QRGF++ + D +LLHIL + P H A+ L Sbjct: 61 SQNEVLDTLLLHKADPRSALVFFKKVERQRGFLKTV-DVLCLLLHILCSSPDTHGDAKYL 119 Query: 267 INDYVSWDSAPSCVVVVDHLIGCSERFGFRLK-PRLFDYFLNGYVRARRYKDAEDCFYSL 91 +N+YV DSAPS V+V+HL+ C+ R+GF L R+F+Y LNGYVRA + DA +CF ++ Sbjct: 120 LNNYVFGDSAPSPKVLVEHLVECAGRYGFELSDSRVFNYLLNGYVRANKITDAVECFRTM 179 Query: 90 VWRGTVPSEIILNNFLKSLIRANVFDN 10 + G +P ++N L ++R N+ DN Sbjct: 180 LEHGVLPWVPVVNILLTVMVRRNMADN 206 >ref|XP_010094870.1| hypothetical protein L484_016452 [Morus notabilis] gi|587868026|gb|EXB57399.1| hypothetical protein L484_016452 [Morus notabilis] Length = 907 Score = 124 bits (312), Expect = 2e-26 Identities = 66/139 (47%), Positives = 89/139 (64%) Frame = -1 Query: 435 VADVLFSYKNDPQTALEYFKSVGKQRGFVREIGDSFFVLLHILVTFPKCHDLARSLINDY 256 V + L S+KNDP +AL+YFK + RGF+R + DSF VLLHIL+ + H A+SL++ Y Sbjct: 89 VINTLLSHKNDPYSALKYFKWAERMRGFIRGV-DSFSVLLHILMGSQETHGSAQSLLSLY 147 Query: 255 VSWDSAPSCVVVVDHLIGCSERFGFRLKPRLFDYFLNGYVRARRYKDAEDCFYSLVWRGT 76 VS DS PS V VDHL C++RF F R+F+Y LN Y+RA R +DA CF +V Sbjct: 148 VSGDSGPSANVFVDHLFDCAKRFEFEPDSRIFNYLLNSYIRANRIRDAVHCFNKMVEHDI 207 Query: 75 VPSEIILNNFLKSLIRANV 19 +P +N L +LIR N+ Sbjct: 208 LPWVPFMNILLTALIRRNM 226 >ref|XP_008370080.1| PREDICTED: pentatricopeptide repeat-containing protein At2g39230, mitochondrial-like [Malus domestica] Length = 860 Score = 124 bits (312), Expect = 2e-26 Identities = 64/159 (40%), Positives = 95/159 (59%) Frame = -1 Query: 480 FPKPVTENAAFSHKDVADVLFSYKNDPQTALEYFKSVGKQRGFVREIGDSFFVLLHILVT 301 F P+++++ + V L S+K+ P +A++YFK ++RG VR + D+ VLLHIL+ Sbjct: 78 FAAPISQDSELTQTSVISTLLSHKSKPYSAIKYFKWAERERGLVRGV-DAVCVLLHILMG 136 Query: 300 FPKCHDLARSLINDYVSWDSAPSCVVVVDHLIGCSERFGFRLKPRLFDYFLNGYVRARRY 121 P H+ A+ L+N YVS DS P V VDHL+ C++RF F L+ ++F Y LN YVRA R Sbjct: 137 SPNTHERAKMLLNQYVSGDSGPVPGVFVDHLVDCAKRFDFELESQVFGYLLNSYVRANRI 196 Query: 120 KDAEDCFYSLVWRGTVPSEIILNNFLKSLIRANVFDNAR 4 + A DCF ++ P +N L L+R N+ AR Sbjct: 197 ECAIDCFNRMLEHEMYPCVTYVNILLTELVRRNMIGEAR 235 >ref|XP_007013815.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] gi|508784178|gb|EOY31434.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 1159 Score = 124 bits (310), Expect = 4e-26 Identities = 67/165 (40%), Positives = 100/165 (60%) Frame = -1 Query: 498 TSKIPTFPKPVTENAAFSHKDVADVLFSYKNDPQTALEYFKSVGKQRGFVREIGDSFFVL 319 T K P +T++ + + V + L ++N+P++AL+YF+ V +RGFVR I D F VL Sbjct: 365 TPKDPRLTPSLTQDTSLTRTHVINTLLIHRNNPESALKYFRFVENKRGFVRSI-DVFCVL 423 Query: 318 LHILVTFPKCHDLARSLINDYVSWDSAPSCVVVVDHLIGCSERFGFRLKPRLFDYFLNGY 139 LHILV + + + L+N +V+ DS P+ +V +DHLI ++RF F L R+F+Y LN Y Sbjct: 424 LHILVGSQQTNKQVKYLLNRFVAGDSGPTPIVFLDHLIDIAKRFDFELDSRVFNYLLNSY 483 Query: 138 VRARRYKDAEDCFYSLVWRGTVPSEIILNNFLKSLIRANVFDNAR 4 VR R DA DCF ++ VP +N L +L+R N+ D AR Sbjct: 484 VRV-RIDDAVDCFNGMIEHDIVPMLPFMNILLTALVRGNLIDKAR 527 >ref|XP_014515022.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Vigna radiata var. radiata] Length = 837 Score = 123 bits (309), Expect = 5e-26 Identities = 63/147 (42%), Positives = 95/147 (64%), Gaps = 1/147 (0%) Frame = -1 Query: 447 SHKDVADVLFSYKNDPQTALEYFKSVGKQRGFVREIGDSFFVLLHILVTFPKCHDLARSL 268 S +V D L +K DP++AL +FK V +QRGF++ + D +LL IL + P H A+ Sbjct: 61 SQNEVLDTLLLHKADPRSALVFFKKVERQRGFLKTV-DVLCLLLQILCSSPSTHGDAKYF 119 Query: 267 INDYVSWDSAPSCVVVVDHLIGCSERFGFRLK-PRLFDYFLNGYVRARRYKDAEDCFYSL 91 +N+YV DSAPS V+V+HL+ C+ R+GF L R+F+Y LNGYVRA + DA +CF ++ Sbjct: 120 LNNYVLGDSAPSAKVLVEHLVECAGRYGFELSDSRVFNYLLNGYVRANKITDAVECFRTM 179 Query: 90 VWRGTVPSEIILNNFLKSLIRANVFDN 10 + G +P ++N L ++R N+ DN Sbjct: 180 LEHGVLPWVPVVNMLLTVMVRRNMADN 206 >ref|XP_009784742.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana sylvestris] gi|698474596|ref|XP_009784743.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana sylvestris] gi|698474598|ref|XP_009784744.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana sylvestris] gi|698474601|ref|XP_009784745.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana sylvestris] Length = 864 Score = 123 bits (309), Expect = 5e-26 Identities = 63/157 (40%), Positives = 94/157 (59%) Frame = -1 Query: 474 KPVTENAAFSHKDVADVLFSYKNDPQTALEYFKSVGKQRGFVREIGDSFFVLLHILVTFP 295 KP++E+ F+ V DVL S+++DP +A YF++ +QRGF+ D FFVLLHILV+ Sbjct: 75 KPISEDGGFTKNHVVDVLLSHRDDPDSAYRYFQTARQQRGFLHTKSDPFFVLLHILVSST 134 Query: 294 KCHDLARSLINDYVSWDSAPSCVVVVDHLIGCSERFGFRLKPRLFDYFLNGYVRARRYKD 115 AR L+++Y DS PS VV + L+ + F F L PR+F++ +N V+ R D Sbjct: 135 MHQHKARRLLDNYAFSDSGPSATVVFNGLVNSYKAFDFELNPRVFNFLINSCVKVNRLTD 194 Query: 114 AEDCFYSLVWRGTVPSEIILNNFLKSLIRANVFDNAR 4 A DCF +V +P I+N LK+L+R ++ AR Sbjct: 195 AIDCFNRMVELDIMPWIPIMNKLLKALVRQDMIGVAR 231 >ref|XP_006450492.1| hypothetical protein CICLE_v10010816mg [Citrus clementina] gi|568859583|ref|XP_006483317.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Citrus sinensis] gi|557553718|gb|ESR63732.1| hypothetical protein CICLE_v10010816mg [Citrus clementina] Length = 850 Score = 123 bits (309), Expect = 5e-26 Identities = 67/162 (41%), Positives = 97/162 (59%), Gaps = 1/162 (0%) Frame = -1 Query: 486 PTFPKPVT-ENAAFSHKDVADVLFSYKNDPQTALEYFKSVGKQRGFVREIGDSFFVLLHI 310 P FP+ T + S V L S +N+P +A EYFK V ++RGF++ + D+F VLLHI Sbjct: 59 PIFPESNTFQPTDLSQTSVISSLLSCRNEPVSAFEYFKRVERRRGFLKSL-DTFCVLLHI 117 Query: 309 LVTFPKCHDLARSLINDYVSWDSAPSCVVVVDHLIGCSERFGFRLKPRLFDYFLNGYVRA 130 L+ + H AR+L+N YVS S P+ ++DHLI ++RF F L +F Y L YVRA Sbjct: 118 LMKDRESHRYARNLLNHYVSGGSEPTSAAIIDHLIETAKRFDFDLDSGVFSYLLRSYVRA 177 Query: 129 RRYKDAEDCFYSLVWRGTVPSEIILNNFLKSLIRANVFDNAR 4 R DA DC ++ R +P +N+ LK+L+R N+ D A+ Sbjct: 178 DRINDAVDCCNGMIERDIIPLLRSMNSVLKALVRRNLIDEAK 219 >ref|XP_009377786.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Pyrus x bretschneideri] gi|694405904|ref|XP_009377787.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X2 [Pyrus x bretschneideri] Length = 860 Score = 121 bits (304), Expect = 2e-25 Identities = 64/159 (40%), Positives = 94/159 (59%) Frame = -1 Query: 480 FPKPVTENAAFSHKDVADVLFSYKNDPQTALEYFKSVGKQRGFVREIGDSFFVLLHILVT 301 F P ++++ + V L S+K+ P +A++YFK ++RGFVR + D+ VLLHIL+ Sbjct: 78 FAAPTSQDSELTQTSVISTLLSHKSKPYSAVKYFKWAERERGFVRGV-DAVCVLLHILMG 136 Query: 300 FPKCHDLARSLINDYVSWDSAPSCVVVVDHLIGCSERFGFRLKPRLFDYFLNGYVRARRY 121 P + A+ L+N YVS DS P V VDHL+ C++RF F L+ ++F Y LN YVRA R Sbjct: 137 SPNTQERAKMLLNQYVSGDSGPVPGVFVDHLVDCAKRFDFELESQVFGYLLNSYVRANRI 196 Query: 120 KDAEDCFYSLVWRGTVPSEIILNNFLKSLIRANVFDNAR 4 + A DCF ++ P +N L L+R N+ AR Sbjct: 197 ECAIDCFNRILELEMYPCVTYVNILLTELVRRNMIGEAR 235 >ref|XP_012456260.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Gossypium raimondii] gi|763804019|gb|KJB70957.1| hypothetical protein B456_011G097400 [Gossypium raimondii] Length = 872 Score = 120 bits (302), Expect = 3e-25 Identities = 67/167 (40%), Positives = 99/167 (59%), Gaps = 1/167 (0%) Frame = -1 Query: 501 NTSKIPTFPKPVTENAAFSHKDVADVLFSYKNDPQTALEYFKSVGKQRGFVREIGDSFFV 322 ++S P T++A+ + V + L S+K+DP +AL+Y++S+ K+R FV+ I D+F V Sbjct: 57 SSSNEPHLTSFSTQDASLTQSHVINTLLSHKDDPPSALKYYRSIKKKRDFVQSI-DAFCV 115 Query: 321 LLHILVTFPKCHDLARSLINDYVSWD-SAPSCVVVVDHLIGCSERFGFRLKPRLFDYFLN 145 LLHILV + + + +ND D S P+ + +DHLI ++RF F L R F+Y LN Sbjct: 116 LLHILVRSSQTYKHVQYFLNDKFGSDHSGPAPLAFLDHLIDTTKRFDFELNSRAFNYLLN 175 Query: 144 GYVRARRYKDAEDCFYSLVWRGTVPSEIILNNFLKSLIRANVFDNAR 4 GYVR R DA DCF ++ R VP N L +L+R N+ D AR Sbjct: 176 GYVRFNRIDDAVDCFNGMIERNVVPWVPFTNILLTALVRRNLMDKAR 222 >gb|KDO61668.1| hypothetical protein CISIN_1g043440mg, partial [Citrus sinensis] Length = 850 Score = 120 bits (302), Expect = 3e-25 Identities = 63/148 (42%), Positives = 91/148 (61%) Frame = -1 Query: 447 SHKDVADVLFSYKNDPQTALEYFKSVGKQRGFVREIGDSFFVLLHILVTFPKCHDLARSL 268 S V L S +N+P +A EYFK V ++RGF++ + D+F VLLHIL+ + H AR+L Sbjct: 5 SQTSVISSLLSCRNEPVSAFEYFKRVERRRGFLKSL-DTFCVLLHILMKDRESHRYARNL 63 Query: 267 INDYVSWDSAPSCVVVVDHLIGCSERFGFRLKPRLFDYFLNGYVRARRYKDAEDCFYSLV 88 +N YVS S P+ ++DHLI ++RF F L +F Y L YVRA R DA DC ++ Sbjct: 64 LNHYVSGGSEPTSAAIIDHLIETAKRFDFDLDSGVFSYLLRSYVRADRINDAVDCCNGMI 123 Query: 87 WRGTVPSEIILNNFLKSLIRANVFDNAR 4 R +P +N+ LK+L+R N+ D A+ Sbjct: 124 ERDIIPLLRSMNSVLKALVRRNLIDEAK 151 >ref|XP_009604239.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697190350|ref|XP_009604240.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697190352|ref|XP_009604241.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] Length = 864 Score = 119 bits (297), Expect = 1e-24 Identities = 59/149 (39%), Positives = 87/149 (58%) Frame = -1 Query: 474 KPVTENAAFSHKDVADVLFSYKNDPQTALEYFKSVGKQRGFVREIGDSFFVLLHILVTFP 295 +P +++ F+ V DVL S+++DP +A YF++ QRGF+ D FFVLLHILV+ Sbjct: 75 RPFSKDGGFTKNHVVDVLLSHRDDPDSAYRYFQTARLQRGFLHTKSDPFFVLLHILVSCT 134 Query: 294 KCHDLARSLINDYVSWDSAPSCVVVVDHLIGCSERFGFRLKPRLFDYFLNGYVRARRYKD 115 AR L+++Y DS PS V+ + L+ C + F F L PR+F++ +N V+ R D Sbjct: 135 MHQHKARRLLDNYAFSDSGPSATVIFNGLVNCCKAFDFELNPRVFNFLINSCVKVNRLND 194 Query: 114 AEDCFYSLVWRGTVPSEIILNNFLKSLIR 28 A DCF +V P I N LK+L+R Sbjct: 195 AIDCFNEMVELDITPWIPITNKLLKALVR 223 >ref|XP_009615415.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697122855|ref|XP_009615416.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697122857|ref|XP_009615417.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697122859|ref|XP_009615418.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] Length = 864 Score = 118 bits (295), Expect = 2e-24 Identities = 60/157 (38%), Positives = 92/157 (58%) Frame = -1 Query: 474 KPVTENAAFSHKDVADVLFSYKNDPQTALEYFKSVGKQRGFVREIGDSFFVLLHILVTFP 295 +P +E+ F+ V DVL S+++DP +A YF++ +QRGF+ D FFVLLHILV+ Sbjct: 75 RPNSEDGGFTKNHVVDVLLSHRDDPDSAYRYFQTARQQRGFLHTKSDPFFVLLHILVSST 134 Query: 294 KCHDLARSLINDYVSWDSAPSCVVVVDHLIGCSERFGFRLKPRLFDYFLNGYVRARRYKD 115 AR L+++Y DS PS V+ + L+ + F F L PR+F++ +N V+ D Sbjct: 135 MHQHKARRLLDNYAFSDSGPSATVIFNGLVNSCKAFDFELNPRVFNFLINSCVKVNGLND 194 Query: 114 AEDCFYSLVWRGTVPSEIILNNFLKSLIRANVFDNAR 4 A DCF +V +P I+N LK+L+R ++ AR Sbjct: 195 AIDCFNGMVELDIMPWIPIMNKLLKALVRQDMIGVAR 231