BLASTX nr result
ID: Perilla23_contig00030288
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00030288 (531 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098529.1| PREDICTED: chloroplastic group IIA intron sp... 62 2e-07 >ref|XP_011098529.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic [Sesamum indicum] Length = 1054 Score = 61.6 bits (148), Expect = 2e-07 Identities = 33/46 (71%), Positives = 34/46 (73%) Frame = -2 Query: 530 GIEPSQASGKGIVDLKRDSMGGEVTARPIISPELISAIRLECGLIS 393 G+EP QASGK DLK DS GE AR ISPELISAIRLECGL S Sbjct: 1008 GVEPDQASGKVNKDLKNDSARGEAKARQHISPELISAIRLECGLKS 1053