BLASTX nr result
ID: Perilla23_contig00030251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00030251 (495 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009399793.1| PREDICTED: myb family transcription factor A... 57 5e-06 ref|XP_006493810.1| PREDICTED: myb family transcription factor A... 57 5e-06 ref|XP_006420903.1| hypothetical protein CICLE_v10005596mg [Citr... 57 5e-06 >ref|XP_009399793.1| PREDICTED: myb family transcription factor APL-like isoform X2 [Musa acuminata subsp. malaccensis] gi|694997520|ref|XP_009399800.1| PREDICTED: myb family transcription factor APL-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 197 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 81 AEATPKAIMRTMGVKGLTLFHLKSHLQ 1 AEATPKAIMRTMGVKGLTLFHLKSHLQ Sbjct: 2 AEATPKAIMRTMGVKGLTLFHLKSHLQ 28 >ref|XP_006493810.1| PREDICTED: myb family transcription factor APL-like isoform X2 [Citrus sinensis] Length = 303 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 99 LSLALFAEATPKAIMRTMGVKGLTLFHLKSHLQ 1 + L +F EATPK IMRTMGVKGLTL+HLKSHLQ Sbjct: 55 VQLVVFIEATPKTIMRTMGVKGLTLYHLKSHLQ 87 >ref|XP_006420903.1| hypothetical protein CICLE_v10005596mg [Citrus clementina] gi|557522776|gb|ESR34143.1| hypothetical protein CICLE_v10005596mg [Citrus clementina] Length = 278 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 99 LSLALFAEATPKAIMRTMGVKGLTLFHLKSHLQ 1 + L +F EATPK IMRTMGVKGLTL+HLKSHLQ Sbjct: 30 VQLVVFIEATPKTIMRTMGVKGLTLYHLKSHLQ 62