BLASTX nr result
ID: Perilla23_contig00030130
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00030130 (405 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012832482.1| PREDICTED: probable protein phosphatase 2C 3... 77 4e-12 gb|EYU21006.1| hypothetical protein MIMGU_mgv1a0083482mg, partia... 77 4e-12 ref|XP_011090842.1| PREDICTED: probable protein phosphatase 2C 3... 74 6e-11 >ref|XP_012832482.1| PREDICTED: probable protein phosphatase 2C 35 [Erythranthe guttatus] gi|848920265|ref|XP_012857059.1| PREDICTED: probable protein phosphatase 2C 35 [Erythranthe guttatus] gi|604342513|gb|EYU41543.1| hypothetical protein MIMGU_mgv1a008355mg [Erythranthe guttata] Length = 376 Score = 77.4 bits (189), Expect = 4e-12 Identities = 30/49 (61%), Positives = 38/49 (77%), Gaps = 2/49 (4%) Frame = -2 Query: 167 MPKFFSALLPTNWCCRC--IPRFLNLRWKMGCIQGKCCRKYAPSSDGDN 27 MPKF S +LP NWC R P+FLN+RWKMGC+Q KCC++Y PSSD ++ Sbjct: 1 MPKFLSGILPNNWCSRANFFPKFLNIRWKMGCVQAKCCKRYPPSSDDES 49 >gb|EYU21006.1| hypothetical protein MIMGU_mgv1a0083482mg, partial [Erythranthe guttata] Length = 331 Score = 77.4 bits (189), Expect = 4e-12 Identities = 30/49 (61%), Positives = 38/49 (77%), Gaps = 2/49 (4%) Frame = -2 Query: 167 MPKFFSALLPTNWCCRC--IPRFLNLRWKMGCIQGKCCRKYAPSSDGDN 27 MPKF S +LP NWC R P+FLN+RWKMGC+Q KCC++Y PSSD ++ Sbjct: 1 MPKFLSGILPNNWCSRANFFPKFLNIRWKMGCVQAKCCKRYPPSSDDES 49 >ref|XP_011090842.1| PREDICTED: probable protein phosphatase 2C 35 [Sesamum indicum] Length = 378 Score = 73.6 bits (179), Expect = 6e-11 Identities = 32/57 (56%), Positives = 39/57 (68%), Gaps = 2/57 (3%) Frame = -2 Query: 167 MPKFFSALLPTNWCCRC--IPRFLNLRWKMGCIQGKCCRKYAPSSDGDNKEEMGVFP 3 MPKF S LP+ WC + + KMGCIQGKCCRK+APSS DNKEE+G++P Sbjct: 1 MPKFLSGFLPSKWCASANFFRKCFHFTCKMGCIQGKCCRKHAPSSRSDNKEELGLYP 57