BLASTX nr result
ID: Perilla23_contig00029905
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00029905 (583 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095531.1| PREDICTED: uncharacterized protein LOC105174... 62 3e-07 ref|XP_012848564.1| PREDICTED: pheromone-processing carboxypepti... 58 4e-06 gb|EYU27432.1| hypothetical protein MIMGU_mgv1a012183mg [Erythra... 58 4e-06 >ref|XP_011095531.1| PREDICTED: uncharacterized protein LOC105174958 [Sesamum indicum] Length = 205 Score = 61.6 bits (148), Expect = 3e-07 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -1 Query: 163 FFSANSFQLNKNCLFLICNGLLVFLAKTSGFIQPPSANDVL 41 +FS N+ LNKNCLFLICNGLLVFLAKTSG + PP VL Sbjct: 53 YFSTNNSFLNKNCLFLICNGLLVFLAKTSGTLVPPPPKQVL 93 >ref|XP_012848564.1| PREDICTED: pheromone-processing carboxypeptidase KEX1-like [Erythranthe guttatus] Length = 298 Score = 57.8 bits (138), Expect = 4e-06 Identities = 35/66 (53%), Positives = 40/66 (60%), Gaps = 6/66 (9%) Frame = -1 Query: 187 AGSLKFHQFFSANSFQ------LNKNCLFLICNGLLVFLAKTSGFIQPPSANDVLVGDAF 26 A S KF F + FQ LNKN LFLICNGLLVFLAKTSG ++ PS +D L+ Sbjct: 81 AYSPKFQLFSAKYYFQYLMSRTLNKNFLFLICNGLLVFLAKTSGLVRAPSESDDLLHKKI 140 Query: 25 GASLNK 8 G L K Sbjct: 141 GLELLK 146 >gb|EYU27432.1| hypothetical protein MIMGU_mgv1a012183mg [Erythranthe guttata] Length = 259 Score = 57.8 bits (138), Expect = 4e-06 Identities = 35/66 (53%), Positives = 40/66 (60%), Gaps = 6/66 (9%) Frame = -1 Query: 187 AGSLKFHQFFSANSFQ------LNKNCLFLICNGLLVFLAKTSGFIQPPSANDVLVGDAF 26 A S KF F + FQ LNKN LFLICNGLLVFLAKTSG ++ PS +D L+ Sbjct: 42 AYSPKFQLFSAKYYFQYLMSRTLNKNFLFLICNGLLVFLAKTSGLVRAPSESDDLLHKKI 101 Query: 25 GASLNK 8 G L K Sbjct: 102 GLELLK 107