BLASTX nr result
ID: Perilla23_contig00029812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00029812 (357 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081880.1| PREDICTED: expansin-like B1 [Sesamum indicum] 58 3e-06 >ref|XP_011081880.1| PREDICTED: expansin-like B1 [Sesamum indicum] Length = 257 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/43 (62%), Positives = 30/43 (69%) Frame = +3 Query: 150 MMACLQFVFNFLVATLLLLECVGNAAPCEDCFTQSRAAYYPNS 278 MMA L FN +AT L LE +GNAA C DCF SRAA+YPNS Sbjct: 1 MMAHLWLFFNLFIATFLSLEILGNAATCRDCFIHSRAAHYPNS 43