BLASTX nr result
ID: Perilla23_contig00029627
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00029627 (338 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012842259.1| PREDICTED: pentatricopeptide repeat-containi... 107 5e-21 gb|EYU33400.1| hypothetical protein MIMGU_mgv1a023529mg [Erythra... 107 5e-21 ref|XP_011096622.1| PREDICTED: pentatricopeptide repeat-containi... 99 2e-18 ref|XP_010275050.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_002531431.1| pentatricopeptide repeat-containing protein,... 63 8e-08 ref|XP_006468264.1| PREDICTED: pentatricopeptide repeat-containi... 63 8e-08 ref|XP_006448964.1| hypothetical protein CICLE_v10014263mg [Citr... 61 3e-07 gb|KDO75350.1| hypothetical protein CISIN_1g037695mg [Citrus sin... 60 5e-07 gb|KFK27503.1| hypothetical protein AALP_AA8G391400 [Arabis alpina] 59 1e-06 ref|XP_012453778.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 gb|KJB69879.1| hypothetical protein B456_011G048000 [Gossypium r... 59 2e-06 ref|XP_010940775.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_008225527.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_010112532.1| Pentatricopeptide repeat-containing protein ... 57 5e-06 ref|XP_008775491.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 ref|XP_007159381.1| hypothetical protein PHAVU_002G233400g [Phas... 57 5e-06 ref|XP_007214696.1| hypothetical protein PRUPE_ppa026763mg, part... 57 5e-06 gb|KOM53598.1| hypothetical protein LR48_Vigan09g225700 [Vigna a... 57 7e-06 ref|XP_002272135.2| PREDICTED: pentatricopeptide repeat-containi... 57 7e-06 ref|XP_009115169.1| PREDICTED: pentatricopeptide repeat-containi... 57 7e-06 >ref|XP_012842259.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Erythranthe guttatus] Length = 814 Score = 107 bits (266), Expect = 5e-21 Identities = 59/108 (54%), Positives = 76/108 (70%), Gaps = 3/108 (2%) Frame = -1 Query: 317 SDILDDRKRYFSGIVETVSKEKSL---DYNSNSWGGEKCNLVGFDESDGSEEAEVGKSEE 147 +D + + F GI E S++ + DY+S +WGGEKCN +E SEE E S+E Sbjct: 55 TDNPEGKNHEFGGIGEIGSEKSRIFSPDYSSCNWGGEKCNRGISNEFGESEEGEEENSDE 114 Query: 146 DSDDEDFRVLSSFDRNRERSEASRRIEVDENDLRHPLVREISRLIDRR 3 D+DDE FRVL+SFDRNRERS+ SRRIEVDE+++RHPLVRE+ RLI R Sbjct: 115 DNDDE-FRVLNSFDRNRERSDVSRRIEVDEDEVRHPLVREVCRLIGLR 161 >gb|EYU33400.1| hypothetical protein MIMGU_mgv1a023529mg [Erythranthe guttata] Length = 767 Score = 107 bits (266), Expect = 5e-21 Identities = 59/108 (54%), Positives = 76/108 (70%), Gaps = 3/108 (2%) Frame = -1 Query: 317 SDILDDRKRYFSGIVETVSKEKSL---DYNSNSWGGEKCNLVGFDESDGSEEAEVGKSEE 147 +D + + F GI E S++ + DY+S +WGGEKCN +E SEE E S+E Sbjct: 55 TDNPEGKNHEFGGIGEIGSEKSRIFSPDYSSCNWGGEKCNRGISNEFGESEEGEEENSDE 114 Query: 146 DSDDEDFRVLSSFDRNRERSEASRRIEVDENDLRHPLVREISRLIDRR 3 D+DDE FRVL+SFDRNRERS+ SRRIEVDE+++RHPLVRE+ RLI R Sbjct: 115 DNDDE-FRVLNSFDRNRERSDVSRRIEVDEDEVRHPLVREVCRLIGLR 161 >ref|XP_011096622.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Sesamum indicum] Length = 798 Score = 98.6 bits (244), Expect = 2e-18 Identities = 60/105 (57%), Positives = 73/105 (69%), Gaps = 3/105 (2%) Frame = -1 Query: 308 LDDRKRYFSGIVETVSKEKSLDYNSN---SWGGEKCNLVGFDESDGSEEAEVGKSEEDSD 138 L++RK GI E S+E + ++N SWGG+KCN GFD+ SEE E G+SE DSD Sbjct: 44 LNERKHDSDGIGEMDSRESRILSSANRVYSWGGQKCNRDGFDKFYDSEE-EAGESEGDSD 102 Query: 137 DEDFRVLSSFDRNRERSEASRRIEVDENDLRHPLVREISRLIDRR 3 + DFRVL S+ RER E RRIEVDE++LRHPLVREI RLID R Sbjct: 103 N-DFRVLDSY-MQRERREVPRRIEVDEDELRHPLVREICRLIDLR 145 >ref|XP_010275050.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Nelumbo nucifera] gi|720061056|ref|XP_010275051.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Nelumbo nucifera] gi|720061060|ref|XP_010275052.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Nelumbo nucifera] gi|720061063|ref|XP_010275053.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Nelumbo nucifera] Length = 824 Score = 68.6 bits (166), Expect = 2e-09 Identities = 38/75 (50%), Positives = 51/75 (68%), Gaps = 2/75 (2%) Frame = -1 Query: 221 GEKCNLVGFDESDGSEEAEVGKSEEDSDDED-FRVLSSFDRNRERSEASRRI-EVDENDL 48 GE+ + G+ D S++ E E + DDED FRVL FDRN++ E ++R+ EV+E+ Sbjct: 101 GEEISGGGYKNLDVSDDDEEWDDEGEGDDEDDFRVLDLFDRNKQPKEGTKRVEEVEEDVF 160 Query: 47 RHPLVREISRLIDRR 3 RHPLVREI RLIDRR Sbjct: 161 RHPLVREICRLIDRR 175 >ref|XP_002531431.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528950|gb|EEF30943.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 737 Score = 63.2 bits (152), Expect = 8e-08 Identities = 32/66 (48%), Positives = 42/66 (63%) Frame = -1 Query: 200 GFDESDGSEEAEVGKSEEDSDDEDFRVLSSFDRNRERSEASRRIEVDENDLRHPLVREIS 21 GFDE + +E E S+ D DD F L+S RN + E RIE++E + RHPLVRE+ Sbjct: 18 GFDEIEEDDEDEGEGSDSDVDDSVFMALNSVSRNCGQKEDIWRIEIEEEEFRHPLVREVC 77 Query: 20 RLIDRR 3 RLI+RR Sbjct: 78 RLIERR 83 >ref|XP_006468264.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Citrus sinensis] Length = 837 Score = 63.2 bits (152), Expect = 8e-08 Identities = 44/121 (36%), Positives = 64/121 (52%), Gaps = 10/121 (8%) Frame = -1 Query: 335 SDSASKSDILDDRKRYFSGIVETVSKEKSLDYNSNS----WGGEKCNLVGFDESDG---- 180 SDS +S ++D K YF + K + +S +G + FD+S+ Sbjct: 69 SDSVPESHVVD--KNYFGDSNDGYHKFNQMGTQDSSDLSLFGSDNAE---FDKSEKCDFD 123 Query: 179 --SEEAEVGKSEEDSDDEDFRVLSSFDRNRERSEASRRIEVDENDLRHPLVREISRLIDR 6 +EE E G+ DSDD F VL SFD+ R E RR+ ++E++ RHPLVRE+ RLI+ Sbjct: 124 IFAEEVEEGEDGSDSDDH-FMVLDSFDKYRVNREEIRRVVLEEDEFRHPLVREVCRLIEL 182 Query: 5 R 3 R Sbjct: 183 R 183 >ref|XP_006448964.1| hypothetical protein CICLE_v10014263mg [Citrus clementina] gi|557551575|gb|ESR62204.1| hypothetical protein CICLE_v10014263mg [Citrus clementina] Length = 837 Score = 61.2 bits (147), Expect = 3e-07 Identities = 45/122 (36%), Positives = 65/122 (53%), Gaps = 11/122 (9%) Frame = -1 Query: 335 SDSASKSDILDDRKRYFSGIVETVSKEKSLDYNSNSWGGEKCNLVG-----FDESDG--- 180 SDS +S ++D K YF + K + +S +L G FD+S+ Sbjct: 69 SDSVPESHVVD--KDYFGDNNDGYHKFNQMGTQDSS----DLSLFGSDNGEFDKSEKCDF 122 Query: 179 ---SEEAEVGKSEEDSDDEDFRVLSSFDRNRERSEASRRIEVDENDLRHPLVREISRLID 9 +EE E G+ DSDD +F VL SFD+ R E RR+ ++E++ RHPLVRE+ RLI+ Sbjct: 123 DIFAEEVEEGEDGSDSDD-NFMVLDSFDKYRVNREEIRRVVLEEDEFRHPLVREVCRLIE 181 Query: 8 RR 3 R Sbjct: 182 LR 183 >gb|KDO75350.1| hypothetical protein CISIN_1g037695mg [Citrus sinensis] Length = 701 Score = 60.5 bits (145), Expect = 5e-07 Identities = 34/72 (47%), Positives = 45/72 (62%) Frame = -1 Query: 218 EKCNLVGFDESDGSEEAEVGKSEEDSDDEDFRVLSSFDRNRERSEASRRIEVDENDLRHP 39 EKC+ F +EE E G+ DSDD F VL SFD+ R E RR+ ++E++ RHP Sbjct: 23 EKCDFDIF-----AEEVEEGEDGSDSDDH-FMVLDSFDKYRVNREEIRRVVLEEDEFRHP 76 Query: 38 LVREISRLIDRR 3 LVRE+ RLI+ R Sbjct: 77 LVREVCRLIELR 88 >gb|KFK27503.1| hypothetical protein AALP_AA8G391400 [Arabis alpina] Length = 805 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/65 (46%), Positives = 41/65 (63%) Frame = -1 Query: 197 FDESDGSEEAEVGKSEEDSDDEDFRVLSSFDRNRERSEASRRIEVDENDLRHPLVREISR 18 FDE D EE E + EE++ D+D VL SF + + E R +++E++ RHPLVREI R Sbjct: 85 FDEIDELEEDEEEEDEEENGDDDLAVLESFGKIPQSREDVSRFDIEEDESRHPLVREIGR 144 Query: 17 LIDRR 3 LI R Sbjct: 145 LIGLR 149 >ref|XP_012453778.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242162|ref|XP_012453779.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242164|ref|XP_012453780.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242166|ref|XP_012453781.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242168|ref|XP_012453782.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242170|ref|XP_012453783.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242172|ref|XP_012453784.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] Length = 807 Score = 58.5 bits (140), Expect = 2e-06 Identities = 37/87 (42%), Positives = 54/87 (62%) Frame = -1 Query: 263 SKEKSLDYNSNSWGGEKCNLVGFDESDGSEEAEVGKSEEDSDDEDFRVLSSFDRNRERSE 84 S+E SL + N+ G ++ + FD D EE E + D+DF VL+S++ E++E Sbjct: 76 SRELSL-FGDNNGGYQRNRSLNFDGFDEIEEEE---GDNCRADDDFVVLNSYNVQCEQTE 131 Query: 83 ASRRIEVDENDLRHPLVREISRLIDRR 3 RIE++E++LRHPLVREI RLI R Sbjct: 132 DVWRIELEEDELRHPLVREICRLIQCR 158 >gb|KJB69879.1| hypothetical protein B456_011G048000 [Gossypium raimondii] gi|763802942|gb|KJB69880.1| hypothetical protein B456_011G048000 [Gossypium raimondii] gi|763802943|gb|KJB69881.1| hypothetical protein B456_011G048000 [Gossypium raimondii] gi|763802944|gb|KJB69882.1| hypothetical protein B456_011G048000 [Gossypium raimondii] Length = 737 Score = 58.5 bits (140), Expect = 2e-06 Identities = 37/87 (42%), Positives = 54/87 (62%) Frame = -1 Query: 263 SKEKSLDYNSNSWGGEKCNLVGFDESDGSEEAEVGKSEEDSDDEDFRVLSSFDRNRERSE 84 S+E SL + N+ G ++ + FD D EE E + D+DF VL+S++ E++E Sbjct: 6 SRELSL-FGDNNGGYQRNRSLNFDGFDEIEEEE---GDNCRADDDFVVLNSYNVQCEQTE 61 Query: 83 ASRRIEVDENDLRHPLVREISRLIDRR 3 RIE++E++LRHPLVREI RLI R Sbjct: 62 DVWRIELEEDELRHPLVREICRLIQCR 88 >ref|XP_010940775.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Elaeis guineensis] gi|743761143|ref|XP_010940780.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Elaeis guineensis] gi|743761145|ref|XP_010940785.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Elaeis guineensis] gi|743761147|ref|XP_010940792.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Elaeis guineensis] gi|743761149|ref|XP_010940799.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Elaeis guineensis] gi|743761151|ref|XP_010940808.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Elaeis guineensis] Length = 869 Score = 58.5 bits (140), Expect = 2e-06 Identities = 38/88 (43%), Positives = 48/88 (54%), Gaps = 7/88 (7%) Frame = -1 Query: 245 DYNSNSWGGEKCNLVGFDESDGSEEAEVGKSEED------SDDEDFRVLSSFDRNRERSE 84 D NS C FD+ DG E E G+S++ +DD+DFRVL FD N + E Sbjct: 134 DPNSELKPDSGCRFGAFDDFDG-EGDEDGESDDQMEGGDGNDDDDFRVLDIFDGNADLKE 192 Query: 83 ASRRIEVDEND-LRHPLVREISRLIDRR 3 S+ E +E D RHPLVRE+ RLI R Sbjct: 193 ESKGFEQEEKDESRHPLVREVCRLIGLR 220 >ref|XP_008225527.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Prunus mume] Length = 823 Score = 58.5 bits (140), Expect = 2e-06 Identities = 34/87 (39%), Positives = 48/87 (55%) Frame = -1 Query: 263 SKEKSLDYNSNSWGGEKCNLVGFDESDGSEEAEVGKSEEDSDDEDFRVLSSFDRNRERSE 84 +K DY S+ +G +E DG EE + D DD+D VL S +R E+ E Sbjct: 92 TKNDCEDYQSSKFG----IFDDIEEPDGEEE-----KDSDDDDDDLMVLGSSNRVHEQKE 142 Query: 83 ASRRIEVDENDLRHPLVREISRLIDRR 3 R+E DE++ RHPLVRE+ RL++ R Sbjct: 143 NFVRVEGDEDEFRHPLVREVCRLLELR 169 >ref|XP_010112532.1| Pentatricopeptide repeat-containing protein [Morus notabilis] gi|587947704|gb|EXC33985.1| Pentatricopeptide repeat-containing protein [Morus notabilis] Length = 898 Score = 57.0 bits (136), Expect = 5e-06 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 1/65 (1%) Frame = -1 Query: 194 DESDGSEEAEVGKSEEDSDDED-FRVLSSFDRNRERSEASRRIEVDENDLRHPLVREISR 18 DE D S++ +S+ D D ED F VL+ +RN + E RIE DE LRHPLVRE+ R Sbjct: 83 DEFDDSDDEVEEESDYDDDGEDGFEVLNLSNRNIAQRENVGRIEEDEGQLRHPLVREVCR 142 Query: 17 LIDRR 3 L+D R Sbjct: 143 LVDLR 147 >ref|XP_008775491.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Phoenix dactylifera] gi|672191369|ref|XP_008775492.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Phoenix dactylifera] Length = 851 Score = 57.0 bits (136), Expect = 5e-06 Identities = 35/77 (45%), Positives = 45/77 (58%), Gaps = 7/77 (9%) Frame = -1 Query: 212 CNLVGFDESDGSEEAEVGKSEED------SDDEDFRVLSSFDRNRERSEASRRIEVDEND 51 C FD+ D E E G+S++ +DD+DFRVL FDRN + E S+ E +E D Sbjct: 128 CRFGEFDDFD-DEGDEDGESDDQMEGGDGNDDDDFRVLDIFDRNADLMEESKHFEQEEKD 186 Query: 50 L-RHPLVREISRLIDRR 3 + RHPLVRE RLI R Sbjct: 187 VSRHPLVREACRLIGLR 203 >ref|XP_007159381.1| hypothetical protein PHAVU_002G233400g [Phaseolus vulgaris] gi|561032796|gb|ESW31375.1| hypothetical protein PHAVU_002G233400g [Phaseolus vulgaris] Length = 785 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/62 (46%), Positives = 40/62 (64%), Gaps = 1/62 (1%) Frame = -1 Query: 185 DGSEEAEVGKSEEDSDDEDFRVLSSF-DRNRERSEASRRIEVDENDLRHPLVREISRLID 9 DG+EE E + E SDD+ ++SF NR+ E+ R+E+ E +LRHPLVRE+ RLI Sbjct: 78 DGAEEEESDEREGSSDDDSLEFITSFRGSNRKERESIARVEIGEAELRHPLVREVCRLIT 137 Query: 8 RR 3 R Sbjct: 138 LR 139 >ref|XP_007214696.1| hypothetical protein PRUPE_ppa026763mg, partial [Prunus persica] gi|462410561|gb|EMJ15895.1| hypothetical protein PRUPE_ppa026763mg, partial [Prunus persica] Length = 802 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/64 (45%), Positives = 40/64 (62%) Frame = -1 Query: 194 DESDGSEEAEVGKSEEDSDDEDFRVLSSFDRNRERSEASRRIEVDENDLRHPLVREISRL 15 +E DG EE + D DD+D VL S +R E+ E R+E DE++ RHPLVRE+ RL Sbjct: 90 EEPDGEEE-----KDSDDDDDDLMVLGSSNRVHEQKENFVRVEGDEDEFRHPLVREVCRL 144 Query: 14 IDRR 3 ++ R Sbjct: 145 LELR 148 >gb|KOM53598.1| hypothetical protein LR48_Vigan09g225700 [Vigna angularis] Length = 793 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/62 (45%), Positives = 42/62 (67%), Gaps = 1/62 (1%) Frame = -1 Query: 185 DGSEEAEVGKSEEDSDDEDFRVLSSFD-RNRERSEASRRIEVDENDLRHPLVREISRLID 9 DG+EE + + E SDD+ ++SF N+++SE+ RIE+ E ++RHPLVRE+ RLI Sbjct: 86 DGAEEEQSEEGEGSSDDDSLEFITSFSGSNQQQSESIARIEIGEAEVRHPLVREVCRLIT 145 Query: 8 RR 3 R Sbjct: 146 LR 147 >ref|XP_002272135.2| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Vitis vinifera] Length = 827 Score = 56.6 bits (135), Expect = 7e-06 Identities = 32/95 (33%), Positives = 50/95 (52%), Gaps = 14/95 (14%) Frame = -1 Query: 245 DYNSNSWGGEKCNLVGFDES--------------DGSEEAEVGKSEEDSDDEDFRVLSSF 108 D+++ G ++ +GF ES D E +++ + D +D+D VL+SF Sbjct: 81 DFDAIGEGSDRFKQMGFGESRDLGHFGSGLDDLDDNEESSDIEEGGNDHNDDDLMVLNSF 140 Query: 107 DRNRERSEASRRIEVDENDLRHPLVREISRLIDRR 3 ++E RR E E++ RHPLVREI RLI+ R Sbjct: 141 TGGYRQTEGIRRFEGGEDESRHPLVREICRLIELR 175 >ref|XP_009115169.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Brassica rapa] Length = 802 Score = 56.6 bits (135), Expect = 7e-06 Identities = 34/70 (48%), Positives = 46/70 (65%), Gaps = 5/70 (7%) Frame = -1 Query: 197 FDESD--GSEE--AEVGKSEEDSDDEDFRVLSSFDR-NRERSEASRRIEVDENDLRHPLV 33 FDE D G EE E +S ++ DD+DF VL SF + R R + + R EV+E++ RHPLV Sbjct: 80 FDEIDELGGEEDDEEDEESVDERDDDDFAVLESFGKIPRSREDVNTRFEVEEDESRHPLV 139 Query: 32 REISRLIDRR 3 RE +RLI+ R Sbjct: 140 RETNRLINLR 149