BLASTX nr result
ID: Perilla23_contig00029511
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00029511 (385 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095433.1| PREDICTED: cell differentiation protein RCD1... 60 5e-07 ref|XP_012848357.1| PREDICTED: cell differentiation protein RCD1... 59 2e-06 gb|EYU27360.1| hypothetical protein MIMGU_mgv1a013124mg [Erythra... 59 2e-06 gb|EYU27359.1| hypothetical protein MIMGU_mgv1a013124mg [Erythra... 59 2e-06 >ref|XP_011095433.1| PREDICTED: cell differentiation protein RCD1 homolog [Sesamum indicum] Length = 281 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/53 (56%), Positives = 38/53 (71%), Gaps = 1/53 (1%) Frame = -1 Query: 376 DRRSLMTLKSCFPKRLQDGTFEQCVREDQALRMGLQRLLDNVRGSSINR-GSL 221 D RSL L++ PKRL DGTF+ C+REDQ RM LQ+LLDN+ G + + GSL Sbjct: 224 DGRSLWVLRNFLPKRLTDGTFDHCLREDQTARMWLQQLLDNLSGRPVTKEGSL 276 >ref|XP_012848357.1| PREDICTED: cell differentiation protein RCD1 homolog [Erythranthe guttatus] Length = 408 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = -1 Query: 376 DRRSLMTLKSCFPKRLQDGTFEQCVREDQALRMGLQRLLDNVRGSSI 236 D RS T+++ FPK L DGTF+ C+RE+Q RM LQ+LLDNVRG + Sbjct: 327 DERSHWTMRNPFPKALTDGTFDHCLREEQRARMLLQQLLDNVRGPPV 373 >gb|EYU27360.1| hypothetical protein MIMGU_mgv1a013124mg [Erythranthe guttata] Length = 230 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = -1 Query: 376 DRRSLMTLKSCFPKRLQDGTFEQCVREDQALRMGLQRLLDNVRGSSI 236 D RS T+++ FPK L DGTF+ C+RE+Q RM LQ+LLDNVRG + Sbjct: 149 DERSHWTMRNPFPKALTDGTFDHCLREEQRARMLLQQLLDNVRGPPV 195 >gb|EYU27359.1| hypothetical protein MIMGU_mgv1a013124mg [Erythranthe guttata] Length = 204 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = -1 Query: 376 DRRSLMTLKSCFPKRLQDGTFEQCVREDQALRMGLQRLLDNVRGSSI 236 D RS T+++ FPK L DGTF+ C+RE+Q RM LQ+LLDNVRG + Sbjct: 149 DERSHWTMRNPFPKALTDGTFDHCLREEQRARMLLQQLLDNVRGPPV 195